KEGG   Corynebacterium callunae: H924_00220Help
Entry
H924_00220        CDS       T02507                                 

Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ccn  Corynebacterium callunae
Brite
KEGG Orthology (KO) [BR:ccn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccn01001]
    H924_00220
Enzymes [BR:ccn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     H924_00220
Protein kinases [BR:ccn01001]
 Serine/threonine kinases: Other
  Bacterial family
   H924_00220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 Pkinase_fungal Kdo Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AGG65504
UniProt: M1UII0
LinkDB All DBs
Position
complement(47810..49225)
Genome map
AA seq 471 aa AA seqDB search
MSAEDNTGIERLQQLIGDDYRLQWIIGHGGMSTVWLADDIINDREVAIKVLRPEFSDNRE
FLSRFRNEAQAAENIDSEHVVATYDYREVPDPAGHTFCFIVMEFVRGESLADLLEREGSL
AEDLALDVLEQAAHGLSVIHRMNMVHRDIKPGNMLITANGIVKITDFGIAKAAAAVPLTR
TGMVVGTAQYVSPEQAQGKEVTAASDIYSLGVVGYEMMAGRRPFSGDSSVSVAIAHINQA
PPQMPTSITAQTRELIGIALRKDPGRRFPDGNEMALAVSAVRLGKRPPQPRTEALMVQAE
APSPSASTAMLGKVARPATITQEAAPLRGSGIGIGLFIAALLAIIIGAVIYAGATGMLFQ
ETPEETTTPQTITQTITPTVEETTSVYVPPRTTSRVPSSSLETTSQRPTTSEETSTPSTT
SEEETPSTTSSSSRFSVTPMPTGDNTPNETDAAVSELAEAVSQLMEVGEAQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagaagacaacaccggtatcgaacgtctccaacagctcatcggcgatgactat
cgcctgcagtggattattggccatggtggcatgtccacggtgtggttggctgatgacatt
attaatgatcgcgaagtagccattaaggtgctgcgccctgagttctctgacaaccgggag
ttcctcagccgtttccgaaatgaggcgcaggctgcggaaaatatcgattcggaacatgtt
gtagccacctatgattatcgcgaggtccctgatcccgctggccacaccttctgctttatt
gtcatggagtttgtgcgcggtgaatccctggcggaccttttggaaagagaaggcagccta
gctgaggatctcgccttggatgtgctggagcaagcagcgcacggcctctccgtgattcac
cgcatgaacatggtgcaccgcgatattaagccgggcaatatgctcattactgccaatggc
attgtgaagattacggactttggcatcgccaaggcggcagctgcggtgccacttactcgc
actggcatggtggtgggtactgcgcaatatgtctccccggagcaggcgcagggcaaggaa
gtaacggcagcttctgatatttattctttgggtgtggtcggctatgaaatgatggctggc
cgtcggccttttagtggcgattcttccgtttcggtggcaattgcgcatatcaaccaggca
ccgccacagatgcccaccagcatcactgcccaaacgcgtgagctcattggcattgccttg
cgcaaggatccgggtcgtcgattcccggatggaaatgaaatggctttagccgtttcagca
gtgcgtttgggtaagcggccaccgcaaccgcgcactgaggccttgatggtgcaggccgag
gcgccgtcgccaagcgcctccacggcgatgttaggcaaggtggcccggcctgcgacgatt
acccaagaagcagctcccctgcgtggttcaggtattggcattgggctttttattgctgct
ttgctcgcaattattattggtgctgtcatttatgcgggtgccacaggtatgcttttccaa
gaaactcctgaggaaactaccactccgcagacaattactcagaccattacgccaacggtg
gaagaaaccacctcggtgtatgttccaccgcgtaccacttcacgggtgccaagcagctcc
cttgaaacaacttcacagcgtccaacgacaagtgaagagaccagtacaccttcaacaact
tcggaagaagaaaccccttcaaccactagttcaagctctcgtttttccgtcaccccaatg
cctaccggcgataacactcccaacgagactgatgctgcagtttctgaactagccgaggct
gttagtcaattaatggaagtaggagaagcgcagtga

DBGET integrated database retrieval system