KEGG   Corynebacterium callunae: H924_02330Help
Entry
H924_02330        CDS       T02507                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ccn  Corynebacterium callunae
Pathway
ccn00250  Alanine, aspartate and glutamate metabolism
ccn00280  Valine, leucine and isoleucine degradation
ccn00310  Lysine degradation
ccn00410  beta-Alanine metabolism
ccn00640  Propanoate metabolism
ccn00650  Butanoate metabolism
ccn01100  Metabolic pathways
ccn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    H924_02330
   00650 Butanoate metabolism
    H924_02330
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H924_02330
   00280 Valine, leucine and isoleucine degradation
    H924_02330
   00310 Lysine degradation
    H924_02330
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H924_02330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccn01007]
    H924_02330
Enzymes [BR:ccn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     H924_02330
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     H924_02330
    2.6.1.48  5-aminovalerate transaminase
     H924_02330
Amino acid related enzymes [BR:ccn01007]
 Aminotransferase (transaminase)
  Class III
   H924_02330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGG65920
UniProt: M1UDC0
LinkDB All DBs
Position
504114..505460
Genome map
AA seq 448 aa AA seqDB search
MQDFTYRIPQTRHINEQVPGTQSEALDQRRQAAVARALAPGLPGYVVDADGGILVDADGN
RYIDLASGIAVTTVGASNPAVVQAVAESAARFTHTSFMVSPYESYVAVAEKLNELTPGDH
DKKSALFNSGAEAVENAIKISRAYTGKGAVVVFDNAYHGRTNLTMAMTAKNRPYKSGFGP
LAAEIYRVPASYPLRDGLSGAEAAARTISAIETQVGAENLACVVIEPIQGEGGFIVPAEG
FLPALAQWCRDNDVVFVADEIQSGFQRTGQWFASEAENVVPDLITTAKGIAGGMPLSAVT
GRAEIMDAAGPGSLGGTYGGNPVACAAALAAIDQMETHNLKDRALEIEAIIRDEFAPLLE
LPEVAELRGRGAMMALELLDAAGRPNPALTAAVAQRAKAAGVLTLTCGTDGNVIRLLPAL
VISEDTLRDGLQVIAAAIEHETATQKVG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagatttcacctaccgcatcccccagacccgccacatcaacgagcaggtcccagga
acccaatctgaagcattggatcagcgtcgccaagcagcagttgcccgcgcactagcgccg
ggcctgcctggatacgtcgttgatgcagacggcggcatcttggttgacgccgatggaaac
cgctacatcgacctcgcttccggcattgcagtaaccacggtcggcgcctccaaccctgcc
gttgtacaggcggtagctgagtctgctgctcgcttcacccacaccagcttcatggtttcc
ccctatgagtcctacgtggcagtggctgaaaagctcaatgaactcacccctggtgaccac
gacaaaaagagtgcactttttaactccggtgcggaagccgtggaaaacgccatcaagatt
tcccgcgcctacaccggcaagggtgccgtagttgtttttgacaatgcctaccacggtcgc
accaacctcaccatggcaatgaccgcaaaaaaccgcccttataagtctggtttcggccct
ctagctgcagagatctaccgcgtcccagcttcctacccactgcgcgatggtctcagtggc
gctgaggcggcagcgcgcaccatctccgcaattgaaacccaggttggcgcagaaaacctg
gcttgtgtagtaatcgagccaatccagggcgaaggcggattcatcgtcccagccgagggc
ttcttgcctgcacttgcacagtggtgccgcgataatgatgtcgtctttgtcgcagacgaa
atccagtccggcttccagcgcactggccagtggttcgcgagcgaggctgaaaatgtggtt
cctgacctcatcaccaccgcaaagggcatcgccggcggtatgccactatctgccgtaacc
ggtcgcgcagaaatcatggacgctgctggcccaggctccctcggtggcacctacggcggc
aacccagttgcttgtgctgcagcactagctgccattgaccagatggaaactcataacttg
aaggatcgcgcgctggaaatcgaagccatcattcgtgatgaattcgctccactgcttgag
ctgcctgaggttgctgagctccgcggccgcggagccatgatggcccttgagcttctcgac
gccgccggccgccctaacccagcactgaccgcagcggtggcacagcgtgccaaggctgcc
ggtgttttgaccttgacctgtggcaccgacggcaatgtcatccgtttgctgcctgctttg
gttatttccgaggacaccttgcgcgatggtctgcaggttattgcagcagctattgagcac
gagaccgcaactcagaaagttggctaa

DBGET integrated database retrieval system