KEGG   Corynebacterium callunae: H924_02400Help
Entry
H924_02400        CDS       T02507                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ccn  Corynebacterium callunae
Brite
Translation factors [BR:ccn03012]
 Eukaryotic Type
  Elongation factors
   H924_02400
 Prokaryotic Type
   H924_02400
Mitochondrial biogenesis [BR:ccn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    H924_02400
Exosome [BR:ccn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   H924_02400
  Exosomal proteins of breast cancer cells
   H924_02400
  Exosomal proteins of colorectal cancer cells
   H924_02400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AGG65934
UniProt: M1UJF5
LinkDB All DBs
Position
525970..527160
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAFPDLNEAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEDAPIVHISALKAL
EGDEKWGKQILELMQACDDNIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGSLNV
NDDVEIIGIKEKSTSTTVTGIEMFRKLLDSAEAGDNCGLLLRGIKREDVERGQVIVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtaccaagccccacgtaaacatcggcaccatcggtcac
gttgaccacggtaagaccaccaccaccgcggctatcaccaaggttctggctgatgctttc
ccagatctcaacgaggctttcgccttcgacgccatcgacaaggctccggaggagaaggag
cgtggtattaccattaacatctcccacgttgagtaccagaccgagaagcgccactacgca
cacgttgacgctccaggccacgccgactacatcaagaacatgatcaccggcgctgctcag
atggacggcgcaatcttggttgttgctgctaccgacggcccaatgcctcagacccgtgag
cacgttcttcttgctcgccaggttggcgttccttacatcctcgttgctcttaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggaagttcgcgaacttctt
gctgagcaggactacgacgaggacgctccaatcgttcacatctccgctcttaaggctctt
gagggtgacgagaagtggggcaagcagattcttgagctcatgcaggcttgtgatgacaac
atcccagacccagttcgtgagaccgataagccattcctcatgcctatcgaggatatcttc
accatcaccggtcgtggcaccgttgttaccggtcgtgttgagcgcggttccctgaacgtt
aacgatgacgtcgagatcatcggcatcaaggagaagtccacctccaccaccgttaccggt
atcgagatgttccgtaagcttcttgactccgctgaagctggcgacaactgtggtctgctt
ctccgcggcatcaagcgcgaagacgtagagcgtggccaggttatcgttaagccaggcgct
tacacccctcacaccgagttcgagggctctgtctacgttctgtccaaggatgaaggcggc
cgccacaccccattcttcgacaactaccgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttccagagggcaccgagatggttatgcctggcgacaacgtcgac
atgagcgtcaccttgatccagccagttgctatggatgagggcctgcgtttcgctatccgc
gaaggctcccgcaccgttggcgccggccgtgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system