KEGG   Corynebacterium callunae: H924_07990Help
Entry
H924_07990        CDS       T02507                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ccn  Corynebacterium callunae
Pathway
ccn00010  Glycolysis / Gluconeogenesis
ccn00520  Amino sugar and nucleotide sugar metabolism
ccn01100  Metabolic pathways
ccn01110  Biosynthesis of secondary metabolites
ccn01120  Microbial metabolism in diverse environments
ccn01130  Biosynthesis of antibiotics
ccn01200  Carbon metabolism
Module
ccn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H924_07990
   00520 Amino sugar and nucleotide sugar metabolism
    H924_07990
Enzymes [BR:ccn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     H924_07990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AGG67040
UniProt: M1UFR7
LinkDB All DBs
Position
1707049..1707801
Genome map
AA seq 250 aa AA seqDB search
MTETGFGIDVGGSGIKGARVDLTTGEFIGERIKIATPQPATPEAVAEVVAQILAEAEWDG
PVGITLPSVVRGQIALSAANIDKSWIGTDVHELFARHLGEREIAVLNDADAAGIAEATFG
DPAAREGAVILLTLGTGIGSAFLVDGTLFPNTELGHLVVDGVEAEHRASAAVKENEDLSW
KKWSKQLNKVLQEYEKLFSPSLFIMGGGISRKHDKWMPLLELDTEVVPAQLRNRAGIVGA
AMAVSKHLNP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaccggatttggaattgatgtcggtggttccggcattaaaggcgctcgtgtg
gatctcaccacgggtgaatttatcggtgagcgaattaaaatcgccaccccgcaacctgca
acccctgaagccgtcgcagaagtagtagctcaaattttggcagaggcagagtgggacggc
ccagtaggcattaccctgccgtctgtggtgcgtggccaaattgctttgtctgccgccaat
attgataaatcgtggatcggcaccgatgttcatgagctttttgctcgacatctaggtgag
cgagagatcgcggtgctcaacgacgccgatgcagctggtatcgcagaggcaacctttggt
gatcccgcagcccgcgaaggtgccgtcatcttattaaccctgggcactggcatcggctca
gcgttcctggttgatggcacccttttccccaacactgagttaggccaccttgttgttgat
ggcgtcgaggcagaacaccgcgcttcagctgcagtaaaggagaatgaggatctctcctgg
aagaagtggagcaagcagctcaacaaggtgttgcaggaatatgaaaagctcttctcccct
tccctattcataatgggtggtggcatttcccgaaagcatgacaagtggatgccacttttg
gagcttgacaccgaggttgtaccagcacaactgcgcaatcgtgcaggaattgtcggtgcc
gcgatggcagtgtctaaacacctcaacccttaa

DBGET integrated database retrieval system