KEGG   Campylobacter concisus 13826: CCC13826_0112Help
Entry
CCC13826_0112     CDS       T00593                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cco  Campylobacter concisus 13826
Pathway
cco00473  D-Alanine metabolism
cco00550  Peptidoglycan biosynthesis
cco01100  Metabolic pathways
cco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cco00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CCC13826_0112 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CCC13826_0112 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CCC13826_0112 (ddlA)
Enzymes [BR:cco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CCC13826_0112 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:cco01011]
 Precursor biosynthesis
  Amino acid ligase
   CCC13826_0112 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATPgrasp_TupA Arg_tRNA_synt_N MEF2_binding
Motif
Other DBs
NCBI-ProteinID: ABW74793
UniProt: A8Z6L3
LinkDB All DBs
Position
complement(1064086..1065126)
Genome map
AA seq 346 aa AA seqDB search
MNLGVIFGAKSFEHEISIVSAIVLKNVLKQGLKFIFCDANRDFYLIEQKDMRANFFSSGK
YKNSKKLSLAKGGFYTHSLFGANKVECDVIINLIHGMDGEDGKIAALFEFYGVKYIGPRL
EASALSYNKELTKFLAQKAGVKALDYEMLTRQSEPKFHYPIILKPARLGSSIGVSVVHDD
SELAYAKDVAFEFDKDVLVEPFIKGVKEYNLAGCRIDGKIKFSIVEEPKKKEFLDYEQKY
LSFSNENKVKEAEISEELKQKLKFNFSKIYDCGFDGAIIRCDFFVIDDEVYLNEINPNPG
SLANYLFEDFESTLNALANSLPKEREIKIDYKFINSITSVKGSGKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaggcgtgatatttggggcaaagagttttgagcatgagataagcatagtaagt
gcgatagttttaaaaaacgtcctaaaacaggggttaaaatttatattttgcgatgcaaac
agggacttttacttgatcgagcaaaaagatatgagagcaaatttctttagctctggcaaa
tacaaaaactcaaagaagctatctttagcaaagggcggcttttacacgcactcacttttt
ggcgcaaacaaagttgaatgtgacgtcattataaatttgatccacggcatggacggcgaa
gatggcaagatagcggcactttttgaattttacggggtcaaatacataggtccaaggctt
gaagcaagcgcgcttagctacaacaaagagcttactaaatttctagcgcaaaaggctggt
gtaaaggcgcttgattacgagatgctaactcgtcaaagcgagccaaaatttcactatcct
attatattaaagccagcaaggctaggcagcagcatcggcgtgagcgtcgtgcatgatgat
agtgagcttgcctacgcaaaagacgtggcgtttgaatttgacaaagatgttttggtagag
ccctttataaaaggcgtcaaagagtacaaccttgcaggctgcaggatcgatggaaagatc
aaattttctatcgtcgaagagccaaaaaagaaagaatttcttgactatgagcaaaaatat
ctaagtttttcaaatgaaaataaggtaaaagaggcggaaatttctgaagagctaaagcaa
aagcttaaatttaacttttctaaaatttatgattgtggatttgacggagcgatcattaga
tgcgactttttcgtgatagatgacgaggtttatctaaacgagatcaatccaaacccaggc
agccttgcaaactatctatttgaggactttgagagcacactaaatgcccttgcaaactca
cttccaaaagagcgtgagataaagattgattataaatttataaactcgatcacttcggta
aaaggcagcggtaagctctag

DBGET integrated database retrieval system