KEGG   Campylobacter concisus 13826: CCC13826_0708Help
Entry
CCC13826_0708     CDS       T00593                                 

Gene name
flgK
Definition
(GenBank) flagellar hook-associated protein
  KO
K02396  flagellar hook-associated protein 1 FlgK
Organism
cco  Campylobacter concisus 13826
Pathway
cco02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:cco00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    CCC13826_0708 (flgK)
Bacterial motility proteins [BR:cco02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    CCC13826_0708 (flgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C Flg_bb_rod Fib_alpha DUF5490
Motif
Other DBs
NCBI-ProteinID: EAT97207
UniProt: A7ZD58
LinkDB All DBs
Position
851301..853172
Genome map
AA seq 623 aa AA seqDB search
MANIFMSLGTGVSGLNAAQVQISTTGNNITNADSNYYTRQRVVQSASPAMNTVPGGVGTG
TQVDTVTRLHDEFAYSRLKYSSSNLENTGYKQRILQEATKYFPDLKDNGMVKDIQEYFAA
WNNFASNPDEGAQKVNLINKASVLTASINRSSKMLYDMHTQIDETIKININEINSLGKQI
ANINKQIQRVESGADAGIKINANDLRDKRDELELAMSKLVNTAVYKSDLKSESRIDTGIS
DQGRYYNLNIGGVSIVDGVNFHEISMSSTESGQYTKIYYEREDGRRIPMEEKITNGKIGA
ALDLRGRNYEPDNDKFSDGIIQKYIDNLNTFSKTLITSTNNVYAESAVEISNSDPISYLE
NDKTLMNHDNSIRNGSFEAIVYDNKGNVVAKKTIEINGTTTMNDTKYGNSVVQDFNSNSD
DNNDNNMLNDVDDFFEASYFYDKNTHQGTFALIPKQAQGLYSISIVDHGTNFPGVVGINR
FFSGTNSNTIGINQNFTQDHTKLRAYSKPVVGNNEVANKMIQLQYQKQTFYSSGTALDRD
ETIEGYYRYFTTDMASDTEANNTIHDTNTSLQRTAEEEFQSTSGVDTNEELTNLIRFQAS
YGAAAKIITTVDQMLDTLLSLKQ
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggctaatatctttatgtcattaggcacaggcgtttcaggactaaatgcagcccaagtg
caaataagcacaaccggaaacaacatcacaaacgccgatagtaactactatacaagacag
cgtgtagtgcagtctgcgtctccagcgatgaacacagtccctggtggcgttggcacaggt
acacaagtagatactgtgacaagacttcatgacgagtttgcctactcaagactaaagtac
tcatcatcaaatttagaaaatacaggctataaacagagaattttacaagaggcgacaaaa
tacttcccagatctaaaagataacggcatggtaaaagatatccaagagtattttgcagcg
tggaataacttcgcttcaaacccagacgagggcgctcaaaaggtaaatttgataaacaaa
gctagcgttttaacagctagcatcaaccgctcatcaaagatgctttatgatatgcacact
cagatagatgagactataaagataaatataaacgagataaactcacttggcaagcaaata
gcaaatatcaataagcaaattcaaagagttgaatcaggcgcagacgctggtatcaagata
aatgctaacgaccttcgcgacaagcgcgatgagctagagcttgctatgtcaaagctggta
aatacagctgtttataaaagcgatctaaaaagcgagtcaaggatagatactggcataagc
gatcaaggaagatactacaacctaaatatcggcggtgtgagtatcgttgatggtgtaaat
tttcatgaaatttctatgagctcaaccgagagtgggcaatacactaaaatttattatgaa
agagaagatggcagacgtatccctatggaggagaagatcacaaatggcaagataggagct
gcacttgatcttagaggccgtaactacgaaccagataatgataaatttagcgatggtatc
atccaaaaatatatcgataacctaaatacattttcaaaaactttaataactagcacaaac
aacgtctatgccgagtctgcggttgaaatttcaaactcagatccgatcagctacctagaa
aacgacaagacactgatgaaccacgataacagcataagaaacggcagctttgaagccata
gtttatgataacaaaggcaacgtagtagccaaaaagactatcgagataaacggcacaacg
acgatgaatgatacaaaatacggcaactctgttgtgcaggattttaactcaaattcagac
gataacaacgacaacaacatgctaaatgacgtcgatgacttctttgaagcgtcgtatttt
tatgataaaaacacgcaccaaggcacatttgcgctcataccaaagcaagctcaagggctt
tatagtatatcaatagtcgatcacggcacaaatttcccaggtgttgttggtatcaacaga
tttttttctggcacaaactcaaatacaatcggtatcaatcaaaatttcacccaagatcac
acaaagcttcgtgcctactcaaagccagtcgtgggtaacaacgaagttgcaaacaagatg
attcagcttcagtaccaaaagcagacattttactcaagtggcactgcgcttgacagagat
gagacgatcgagggatattaccgctattttacgaccgatatggcgagcgatactgaggcg
aacaacactatccacgacacaaacacatctttgcaaaggactgctgaagaggaatttcaa
tcaacaagcggcgtcgataccaacgaagagcttacaaacttgatccgctttcaagcgagc
tacggtgcagctgcaaagatcattacaaccgttgatcagatgctagacacccttctttca
ctaaaacaatga

DBGET integrated database retrieval system