KEGG   Campylobacter concisus ATCC 33237: CCON33237_0019Help
Entry
CCON33237_0019    CDS       T04635                                 

Gene name
aroC
Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
ccoc  Campylobacter concisus ATCC 33237
Pathway
ccoc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccoc01100  Metabolic pathways
ccoc01110  Biosynthesis of secondary metabolites
ccoc01130  Biosynthesis of antibiotics
ccoc01230  Biosynthesis of amino acids
Module
ccoc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ccoc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCON33237_0019 (aroC)
Enzymes [BR:ccoc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     CCON33237_0019 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: ALF46751
UniProt: A0A0M4TLD4
LinkDB All DBs
Position
complement(21623..22690)
Genome map
AA seq 355 aa AA seqDB search
MNTFGKKLTLTTFGESHGVAIGGVIDGLPAGMKVDTQFIQSELDRRRPGQSNFTTARDEA
DKIEIFSGLFNGISTGAPIGFAIFNNNQKSNDYENLREIFRPGHADFTYFKKYGFRDHRG
GGRSSARETAIRVAGGAFAQLLLNEFNIEVLSGVFGIGKIFSDKIDFNFAKNSQIYALGN
EEAMKEAVNKARNDHDSVGAVVLSVVKNAPAGLGEPLYDKLDGALAAALMGINGVKAVEI
GAGVKASETFGSVNNDEMDELGFLSNNAGGILGGISSGEDIILKSHFKPTPSIFKEQKTL
NLQGKAVDFELRGRHDPCIGIRGSVVATAMIRLVIADMLLLNATTKLENLKKIYG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttgaatacatttggcaaaaaactaaccctaacaacatttggcgagagtcacggagtagcc
ataggtggcgttatagacggtcttcctgctggaatgaaagtcgatacgcagtttatccaa
agcgagctagatagacgccgtcctggacaaagcaacttcacaaccgcaagagatgaagct
gacaagatagaaatttttagcggcctttttaatggcataagtactggagcaccgataggt
tttgctatctttaacaacaaccaaaagtcgaatgactatgaaaatttacgtgaaattttc
cgcccaggccatgctgattttacatattttaaaaaatatggctttagagatcacaggggc
ggtgggcgttcaagtgctagagaaacggctatcagggtagctggtggggcttttgcacag
ctacttttaaatgagtttaatattgaggttttgagcggggtatttggcatcggcaagatt
tttagcgataagatagactttaattttgctaaaaattcacaaatttatgctcttggcaac
gaagaagctatgaaagaagcggtaaataaagctagaaatgaccacgatagcgtcggtgca
gttgttttaagtgtggttaaaaatgctccagcaggccttggagagccactttatgataag
ctcgatggtgccttggcggcggctttaatgggcataaatggtgtaaaagccgtcgagata
ggcgctggcgtaaaagcaagcgagacatttggctcagtaaataacgatgagatggatgag
ctcggctttttaagcaacaacgcaggaggcatacttggtggcataagtagtggcgaagat
atcatactaaagagccattttaagcctacaccttcaatatttaaagaacaaaaaacacta
aatttacaaggcaaagcagtggactttgagctaaggggcagacatgatccatgcataggc
atacgtggtagtgtcgttgcaactgcgatgataaggctagtgatcgctgatatgctacta
ctaaatgcgaccacaaagcttgaaaatctaaagaaaatttacggctaa

DBGET integrated database retrieval system