KEGG   Campylobacter concisus ATCC 33237: CCON33237_0983Help
Entry
CCON33237_0983    CDS       T04635                                 

Gene name
mfrB
Definition
(GenBank) methylmenaquinol:fumarate reductase, MfrB subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ccoc  Campylobacter concisus ATCC 33237
Pathway
ccoc00020  Citrate cycle (TCA cycle)
ccoc00190  Oxidative phosphorylation
ccoc00650  Butanoate metabolism
ccoc01100  Metabolic pathways
ccoc01110  Biosynthesis of secondary metabolites
ccoc01120  Microbial metabolism in diverse environments
ccoc01130  Biosynthesis of antibiotics
ccoc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccoc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCON33237_0983 (mfrB)
   00650 Butanoate metabolism
    CCON33237_0983 (mfrB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CCON33237_0983 (mfrB)
Enzymes [BR:ccoc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CCON33237_0983 (mfrB)
    1.3.5.4  fumarate reductase (quinol)
     CCON33237_0983 (mfrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_9 Fer4_8 Fer4_7 Fer2 Fer4_17 Fer4_16 Fer4_10 Fer4_21 Fer4
Motif
Other DBs
NCBI-ProteinID: ALF47662
UniProt: A0A0M3V2G2
LinkDB All DBs
Position
complement(982329..983294)
Genome map
AA seq 321 aa AA seqDB search
MKIIIDRFDGTKKYESTYELTNEEIKGKTLLTVLLDIKQKKDATLNFTASCRSAICGACA
VRVNGHSYLACDTKMNELLAEYDNPESIRISPLGNFRVISDLMVDWEPSIENLRKIRPSI
TAKSEFSAEKGCKQSQKEYEKVALEWDCILCGACASECNKLEADASDYMQPFVFVHAYRA
AFDSRSKDPMPHLKPAIDNGLWMCVKCQECADRCPKGISACKDITDLRIMAIQKGFDDGM
GPDHAEAFLTDLVDGSGRLNEIKLALRSEGVFKNMGKMDIAANLMLAGKMNPLHIFGEED
IEGHDDLVKMINAARKAASKE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattatcgaccgctttgacggaactaaaaaatatgaatcaacttatgagcta
acaaatgaagagatcaaaggcaaaactcttttaacagtgcttcttgatatcaaacaaaaa
aaggatgcgacgttaaatttcacagcatcttgccgctcggcgatatgtggagcgtgcgct
gttagagtaaatggtcactcatatctagcctgtgatacaaagatgaatgagcttttggct
gagtatgacaatccagagagcataagaatttctccacttggaaatttcagggttatatct
gatcttatggttgattgggagccaagtatcgaaaatttacgcaagattaggcctagcatc
actgctaagtcagaatttagcgctgaaaaaggctgtaaacaaagtcaaaaagagtatgaa
aaagtagcgcttgaatgggactgcatactttgcggagcctgtgctagcgagtgtaataaa
cttgaagctgatgcgagtgattatatgcagccatttgtatttgtgcatgcttatagagct
gcatttgactcacgtagtaaagatcctatgccgcacttaaagccagctatagataatggc
ctttggatgtgtgtaaagtgccaagagtgcgctgatcgctgtccaaaaggtataagcgca
tgcaaagatataactgatcttcgcattatggctatacaaaaaggttttgatgatggcatg
ggaccagatcacgctgaggcattcttaaccgatctagttgatggctcaggcagactaaat
gagatcaagcttgcgcttcgctctgagggagtgtttaaaaatatgggcaaaatggatatc
gctgcaaatttaatgcttgcaggcaagatgaatccgcttcatattttcggcgaagaggac
atagaaggtcatgatgatctagtaaaaatgataaatgcggctcgcaaagctgctagtaag
gagtaa

DBGET integrated database retrieval system