KEGG   Campylobacter concisus ATCC 33237: CCON33237_0984Help
Entry
CCON33237_0984    CDS       T04635                                 

Gene name
mfrA
Definition
(GenBank) methylmenaquinol:fumarate reductase, MfrA subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ccoc  Campylobacter concisus ATCC 33237
Pathway
ccoc00020  Citrate cycle (TCA cycle)
ccoc00190  Oxidative phosphorylation
ccoc00650  Butanoate metabolism
ccoc01100  Metabolic pathways
ccoc01110  Biosynthesis of secondary metabolites
ccoc01120  Microbial metabolism in diverse environments
ccoc01130  Biosynthesis of antibiotics
ccoc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccoc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCON33237_0984 (mfrA)
   00650 Butanoate metabolism
    CCON33237_0984 (mfrA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CCON33237_0984 (mfrA)
Enzymes [BR:ccoc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CCON33237_0984 (mfrA)
    1.3.5.4  fumarate reductase (quinol)
     CCON33237_0984 (mfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C HI0933_like Pyr_redox_2 DAO FAD_binding_3 Thi4 TAT_signal GIDA UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: ALF47663
UniProt: A0A0M5TIA9
LinkDB All DBs
Position
complement(983304..985166)
Genome map
AA seq 620 aa AA seqDB search
MSEKFTRREFLQSACISVGALATTAGATNVFAGELPKGNENGLPSVDVLIIGSGGAGLRA
ATAVRKQYPNSTVVVATKMMPSRNATCMAEGGINGVTDFSNGDSFKLHAYDTVKGAAYLA
DQDAVVKFCEAAGAVIHELDHNGMLFSRIDNGDVSRKDNGDVAFRFMGGASKKRCNYAAD
KTGHVLMHACLDDAITAGVKFLMDHELLEIGLEDGKVEGVVLRNIQDGQIYPVLCKSLII
ATGGYTRIFYNRTSVPFIATGDGIAAALKAGLGFEDPEMIQFHPTGVQNGGTLITEAARG
EGGYLLNNKGERFMKNYHEKMELAPRDVVARAIETEIREGRGFGEGMSAYVLCDVRHLGK
DTIMKKLPKIRHTAMLFQNIDLIEQPVPIRPTAHYSMGGVEVAKFDDMSTKIPGIYVGGE
ASCVSIHGANRLGGNSLTDAVVTGDLAGKGAGAYAKDAKFASGKKTSELAKMWQDKFKAI
ATGEGGVNDMYALREELGKNNWDLMGIFRTGTKLDQLSKNLEAIQAKYDTIKVPNQNPVM
NTAFTDYVELGNLILLSRAACLAAQNRLESRGAHTREDYPKRDDVNFLKHSIVTLKDGKL
ELSYKDVVTGIFSLDGKKPE
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaatttaccagaagagaatttctgcaaagtgcctgtattagcgtaggtgcg
ttagctactactgctggtgcaacaaatgtttttgcgggtgagttgccaaaaggtaatgaa
aatggcttaccatctgttgatgtgctaataatcggctctggcggtgctggacttcgtgca
gcaacagccgttcgcaagcaatatccaaactcaaccgtcgttgttgctacaaaaatgatg
ccatctcgcaacgcaacctgtatggcagagggcggcataaatggggttaccgactttagc
aatggagacagctttaagcttcacgcctacgacactgtaaaaggtgcggcctatcttgct
gaccaagatgcggtagtgaaattttgtgaggcagcaggcgcggtcatccatgaactagat
cacaacggtatgctcttttctcgtatagataatggcgacgtatctcgtaaagataatggc
gatgttgcgtttcgctttatgggtggcgctagtaaaaaacgctgtaactacgcggctgat
aaaactggtcacgttttgatgcacgcctgtcttgacgacgctatcacagctggcgttaaa
tttctaatggatcatgagctacttgagatcggtcttgaggatggcaaggttgaaggcgtc
gttcttcgaaacatccaagatggtcaaatttacccagttctatgcaaatctcttatcatc
gcaactggtggatacactagaattttttataaccgtacatcagttccatttatagcaact
ggtgatggcatcgctgctgcgcttaaagcaggtcttggttttgaagaccctgagatgatt
cagtttcacccaactggcgtccaaaatggtggtacactaatcactgaagcagctcgtggc
gagggtggatacttattaaataacaagggcgagcgttttatgaaaaactatcacgaaaag
atggagctagctcctcgtgacgtcgtcgctcgtgcgattgagacagaaattcgtgaaggc
agaggctttggcgagggtatgagcgcttacgtgctttgtgacgttcgccaccttggcaaa
gatactattatgaaaaaacttccaaaaattcgccacacagccatgcttttccaaaatatc
gatctaatcgagcaaccagtgcctatccgtccgacagctcattactcaatgggcggtgtc
gaagtggctaaatttgacgatatgagcacgaaaattcctggaatttatgtaggcggcgag
gcctcatgcgtatctatccacggtgcaaaccgccttggcggcaacagcctaactgatgca
gtggtcactggcgatctagctggtaaaggtgctggcgcatacgcaaaagatgctaaattt
gcaagtggcaaaaagacttcagagctagctaaaatgtggcaggataaatttaaagccata
gcaacaggcgagggtggcgtgaacgacatgtacgcgcttcgcgaggagcttggtaaaaat
aactgggatctaatgggtatctttagaactggtacaaaattagatcagctttctaaaaac
ctagaagccatccaagcaaaatatgacaccatcaaagtgccaaatcaaaatccagtcatg
aacacagcatttaccgactatgtcgagcttggcaaccttatacttctttctcgtgcagca
tgtcttgcagcgcaaaatcgtcttgagagccgtggcgctcacacaagagaggactatcca
aaaagagatgatgtaaatttcttaaaacacagcatagtcacactaaaagacggcaagctt
gaacttagctacaaagacgttgtgacaggcatattttcacttgacggcaagaagccagaa
taa

DBGET integrated database retrieval system