KEGG   Campylobacter concisus ATCC 33237: CCON33237_1058Help
Entry
CCON33237_1058    CDS       T04635                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ccoc  Campylobacter concisus ATCC 33237
Pathway
ccoc00473  D-Alanine metabolism
ccoc00550  Peptidoglycan biosynthesis
ccoc01100  Metabolic pathways
ccoc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccoc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CCON33237_1058 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CCON33237_1058 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CCON33237_1058 (ddlA)
Enzymes [BR:ccoc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CCON33237_1058 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ccoc01011]
 Precursor biosynthesis
  Amino acid ligase
   CCON33237_1058 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_TupA Arg_tRNA_synt_N MEF2_binding
Motif
Other DBs
NCBI-ProteinID: ALF47733
UniProt: A0A0M4STJ9
LinkDB All DBs
Position
complement(1059633..1060673)
Genome map
AA seq 346 aa AA seqDB search
MNLGVIFGAKSYEHEISIVSAIVLKNVLKQELKFIFCDANRDFYLIEQKDMRANFFSSGK
YKNSKKLILSKGGFFIHSLFGDKKVECDVIINLIHGMDGEDGKIAALFDFYGIKYIGPRL
EVSALSYNKELTKFLAQKAGVKALDYEMLTRQSEPKFHYPIILKPARLGSSIGVNIVHDA
SELAYAKDVAFEFDKDVLVEPFIKGVKEYNLAGCKIDGKIKFSIIEEPKKKEFLDYEQKY
LSFSNENKVKEAEISEELKQKLKFNFSKIYDCGFDGAIIRCDFFMIDDEVYLNEINPNPG
SLANYLFEDFESTLNALANSLPRERNIKIDYSFINSITSVKGRGKI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaggtgtgatatttggagcaaagagctatgagcatgagataagcatagttagt
gcgatagttttaaaaaatgtcctaaaacaagagctaaaatttatattttgtgatgcaaat
agagatttttatcttatcgagcaaaaagatatgagagcaaatttctttagctctggtaaa
tacaaaaattcaaaaaagctcattttatctaaaggcggatttttcatacactctcttttt
ggtgataaaaaagtagagtgcgacgtcattataaatttgatccacggcatggatggcgaa
gatggcaagatagcggcactttttgacttttacggcataaaatatataggtccaaggctt
gaagtaagtgcgcttagctacaacaaagagcttactaaatttctagcacaaaaagctggc
gtaaaggcgcttgactatgagatgctaactcgtcaaagtgagccaaaatttcactatcct
attatcttaaagccagcaagacttggaagtagcataggcgtaaatatagtgcatgacgcc
agtgagctagcttacgcaaaagacgtagcatttgagtttgacaaggatgtgcttgtcgag
ccttttataaagggagtaaaagagtacaaccttgcaggctgtaagatagatggaaagata
aaattttctatcatcgaagagccaaaaaagaaagaatttcttgactacgagcaaaaatat
cttagcttttcaaatgaaaacaaggtaaaagaggctgaaatttctgaggagctaaaacaa
aagctcaaatttaacttttcaaaaatttatgattgtggatttgatggagcgatcattaga
tgcgacttttttatgatagatgatgaggtctatctaaatgagataaatccaaatccagga
agccttgcaaactatctatttgaggattttgagagcactttaaacgctcttgcaaactca
cttccaagagagcgtaatataaagattgattatagtttcataaactcgatcacttcagta
aaaggtcgcggaaaaatttag

DBGET integrated database retrieval system