KEGG   Campylobacter coli FB1: VC76_05505Help
Entry
VC76_05505        CDS       T03870                                 

Gene name
pglE
Definition
(GenBank) UDP-N-acetylbacillosamine transaminase
  KO
K15910  UDP-N-acetylbacillosamine transaminase [EC:2.6.1.34]
Organism
ccof  Campylobacter coli FB1
Pathway
ccof00520  Amino sugar and nucleotide sugar metabolism
ccof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VC76_05505 (pglE)
Enzymes [BR:ccof01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.34  UDP-N-acetylbacillosamine transaminase
     VC76_05505 (pglE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase Aminotran_5 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJW58507
UniProt: A0A0Q2Q8X4
LinkDB All DBs
Position
complement(1075692..1076852)
Genome map
AA seq 386 aa AA seqDB search
MRFFLSPPHMGGNELKYIEEVFKSNYIAPLGEFVNRFEESVKDYAQCENALALNSATAAL
HLALRVAGVEQDDIVLASSFTFIASVAPICYLKAKPVFIDCDETFNIDIDLLKLAIKESE
KKPKALILTHLYGNAAKMDEIVQICEKENIILIEDAAEALGSFYKGRALGTFGEFGAYSY
NGNKIITTSGGGMLIGKDKQKIERARFYSTQARENCLHYEHLDYGYNYRLSNVLGAIGVA
QMEVLEQRVLKKREIYEWYKEFLGDSFVFLDELENSRSNRWLSTALIDFDKNEMNAYQKC
IEISQKDLILHPKISKLITDLQKEQIETRPLWKAMHTQEVFKGAKAYVNGNSELFFKKGI
CLPSGTAMSKDNVREISELIIKSVKA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaggttttttctttctcctccgcacatgggtggcaatgagttaaaatatatagaagaa
gtatttaaaagcaattatatagctcctttgggcgaatttgtaaatcgttttgaagaaagt
gttaaagattacgctcaatgcgaaaatgctttggcgctaaattcagctacggccgctttg
cacttggctttaagagtagcaggagtggagcaagatgatattgttttagcttcatctttt
acttttattgcttcagtggctcctatttgctatcttaaggcaaaacctgtttttattgat
tgtgatgagacttttaatatagatattgatctattaaagcttgctattaaagagagcgaa
aaaaaaccaaaagccttaattttaactcatctttatggcaatgcggccaaaatggatgag
atcgtccaaatttgcgaaaaagaaaatattattttaatcgaagatgccgccgaggctttg
ggaagtttttacaagggtagggctttaggaacttttggagaatttggagcttattcttat
aatggaaataaaatcatcaccacttcaggcggtggtatgcttataggtaaagataagcaa
aaaatcgaaagagcgagattttacagcactcaggcaagggaaaattgtttgcattatgaa
catttagattatggttataattaccgcttgagtaatgttttaggcgctattggcgtggcg
caaatggaagttttagaacaaagagtgctaaaaaaaagagaaatttatgagtggtataaa
gaatttttaggtgatagttttgtctttttagatgagcttgaaaattcaagaagcaatcgc
tggttaagcacggctttgattgattttgataaaaacgaaatgaatgcttatcaaaaatgt
atagaaatttcgcaaaaagacttgattttgcatccaaaaatttcaaaacttataacagat
ttgcaaaaagagcaaattgaaacacgcccactttggaaagctatgcatactcaagaggtt
ttcaaaggtgccaaggcttatgtaaatggcaatagtgagttattctttaaaaaagggata
tgcttgccaagtggcacagcgatgagtaaagacaatgtgcgtgaaatttcagaacttatt
atcaagagcgtaaaggcttga

DBGET integrated database retrieval system