KEGG   Campylobacter coli RM5611: YSU_01905Help
Entry
YSU_01905         CDS       T03167                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ccoi  Campylobacter coli RM5611
Pathway
ccoi00061  Fatty acid biosynthesis
ccoi00780  Biotin metabolism
ccoi01100  Metabolic pathways
ccoi01130  Biosynthesis of antibiotics
ccoi01212  Fatty acid metabolism
Module
ccoi_M00083  Fatty acid biosynthesis, elongation
ccoi_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ccoi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YSU_01905
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YSU_01905
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    YSU_01905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccoi01004]
    YSU_01905
Enzymes [BR:ccoi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     YSU_01905
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     YSU_01905
Lipid biosynthesis proteins [BR:ccoi01004]
 Fatty acid synthase
  Component type
   YSU_01905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: AHK74642
LinkDB All DBs
Position
378543..379370
Genome map
AA seq 275 aa AA seqDB search
MIMKGKKGLIVGVANNKSIAYGIAKACYEQGASLAFTFLNDALKKRVEPIAEEFGSNFVY
ELDVNNNEHLDSIAEKIKKDLGEIDFIVHAVAYAPKEALENSFLETSKEAFDIAMGTSVY
SLLSLTRAVLPVLKEKGAILTLSYLGGVKYVPHYNVMGVAKAALESSVRYLARDLGVKGI
RVNAISAGPIKTLAASGIGDFRMILKYNEINAPLKRNVSIEDVGNSAMYLLSDLARGVTG
EVHYVDAGYNIMGMGDVTKDENGNTVLCWDNQKGQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgataatgaaaggcaaaaaaggccttatagtaggcgtagccaataataaatccatagct
tatggtatagcaaaagcttgttatgagcaaggagcaagtttagcttttacttttttaaat
gatgcattaaaaaagcgtgttgagcctatagcagaagaatttggatcaaactttgtttat
gagcttgatgtaaataataacgagcatttagactctatcgctgaaaaaattaaaaaagat
ttaggtgagattgattttatagtacatgctgttgcttatgcgccaaaagaagctttagaa
aattcattcttagaaacttcaaaagaagcttttgatatagctatgggaacttctgtgtat
tctttactttctttaacgcgtgcggtattgccagtattaaaagaaaagggtgcaattttg
actttaagctatcttggcggggtaaaatatgtgcctcattataatgttatgggtgtagca
aaagccgcacttgaaagttctgtgcgttatttagcaagagatctaggagtaaaaggaatt
cgtgttaatgctatttcagcaggtcctattaaaactttagcagcaagtggaataggcgat
tttagaatgatattaaaatacaatgaaatcaatgctccattaaaacgcaatgtaagtatt
gaagatgtaggaaattcagcgatgtatttactcagtgatttagctcgtggtgttacgggt
gaggtgcattatgttgatgcaggatataacatcatgggaatgggagatgtcacaaaagac
gaaaatggaaatactgtgctttgttgggataatcaaaaaggacaataa

DBGET integrated database retrieval system