KEGG   Campylobacter coli RM5611: YSU_05420Help
Entry
YSU_05420         CDS       T03167                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ccoi  Campylobacter coli RM5611
Pathway
ccoi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccoi01100  Metabolic pathways
ccoi01110  Biosynthesis of secondary metabolites
ccoi01130  Biosynthesis of antibiotics
ccoi01230  Biosynthesis of amino acids
ccoi02024  Quorum sensing
Module
ccoi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ccoi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YSU_05420
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    YSU_05420
Enzymes [BR:ccoi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     YSU_05420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: AHK75293
LinkDB All DBs
Position
complement(1065960..1067303)
Genome map
AA seq 447 aa AA seqDB search
MTWTKNSWKNFSIKQQPIYSNQEELNKVLNKLEKLPPLVFAGEVRELQSALARVCRKEAF
LLQGGDCAESFANFGAVNIRDMFKILLQMAIVLTFAGGCPVVKIGRMAGQFAKPRSSDYE
EINGVKLPSYRGDIINGFEFNEKARIPDPNRMLEAYYQSATTLNLLRGFAKGGLANLHEV
HRWNLGFLKKSELHQQYTDISEKISQALDFMEACGINTYNTPSLKEVDIYTSHEALLLPY
EEALTRVDSLSGEIYDCSAHMLWIGERTRGLDEAHVHFLSGVRNPLGVKIGPNASADDVI
ALANALNPNNEEGRLNIIIRMGAEKIATQLPKIFSKLKKEGLNLVYSIDPMHGNTVKAGD
FKTREFDKIMQEVRYFFEIAMSEGVYAGGVHLEMTGQDVTECTGGASNVTAQSLEKRYET
QCDPRLNADQALELAFLIADLVKKARK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacttggactaaaaattcttggaaaaatttttctattaagcagcagcctatttattct
aatcaagaggagctaaataaagtcttaaataaacttgaaaaacttcctcctttggttttt
gcaggtgaagtaagagagcttcaaagtgctttagcaagagtatgccgaaaagaagctttt
ttacttcagggtggagattgtgcagaaagttttgcaaattttggagcagtaaatatacga
gatatgtttaaaattttacttcaaatggctatagttttaacttttgcgggtggttgtccc
gttgttaaaattggtcgtatggcggggcaatttgctaagccaagaagtagcgattatgaa
gagataaatggagtaaagcttccaagttatagaggtgatattattaatggctttgaattt
aatgaaaaagctagaattcctgatccaaatagaatgcttgaagcttactatcaaagtgct
actactttaaatttattgcgcggttttgctaaagggggattagctaatttacacgaggtg
catcgatggaatttaggttttttgaaaaaaagcgagctgcatcaacaatacaccgatatc
agtgagaaaatttctcaggccttagattttatggaggcctgtggtattaatacctataat
actccaagcttaaaagaagttgatatctatacttctcatgaagctttgcttttgccttac
gaggaagctttaactagagtggatagcttaagtggtgaaatttatgattgttcagctcat
atgctttggataggtgagagaactaggggtcttgatgaagctcatgtacactttttaagt
ggagttagaaatcctttaggagtaaaaataggcccaaatgcaagtgctgatgatgtgatc
gctttagctaatgctttaaatccaaacaatgaagagggtagattaaatatcatcattagg
atgggtgctgaaaaaatagcaactcaattgcctaaaattttctctaaacttaaaaaagag
ggattaaatttagtttatagtatagatcctatgcatggtaatacggtaaaagcaggggat
tttaaaacgcgtgaatttgataaaatcatgcaagaagtaagatatttctttgaaatagct
atgagcgaaggtgtatatgcaggtggagttcatcttgaaatgacaggacaggatgtaacc
gaatgtacgggtggtgcgagtaatgttactgcgcaaagtttagaaaaacgctatgagaca
cagtgcgatccaagacttaatgcagatcaggcacttgagcttgcgtttttgattgctgat
ttggttaaaaaggcaagaaaatga

DBGET integrated database retrieval system