KEGG   Cronobacter condimenti: AFK62_01090Help
Entry
AFK62_01090       CDS       T04060                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccon  Cronobacter condimenti
Pathway
ccon00620  Pyruvate metabolism
ccon00680  Methane metabolism
ccon01100  Metabolic pathways
ccon01120  Microbial metabolism in diverse environments
ccon01200  Carbon metabolism
Module
ccon_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ccon00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK62_01090
  Energy metabolism
   00680 Methane metabolism
    AFK62_01090
Enzymes [BR:ccon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AFK62_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALB61201
UniProt: K8ABR2
LinkDB All DBs
Position
complement(232744..235395)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSSRAGNEADRQALLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEIIARTLRKLKDQPDINET
AIRQAVEALSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDHKDIADYERNQITRRLRQ
LIAQSWHTDEIRKNRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEAHLDYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLISELSMVECSDALR
EYVGTEGAQEPYRYLLKGLRAQLLATQGWLEARLKGQKLPKPQGLLTQNEQLWEPLYACY
ESLVSCGLGIIANGELLDTLRRVKAFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSDNTREVLETCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPEAAWRHIMDEL
SDISCTMYRGYVRENQDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQDELETMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVKKELWPLGQELRQLLDADIKVVLDIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEEGKPADACVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgctttgcgaagcaatgtcagtatgctcggcaagttgctcggg
gataccatcaaggatgcgctgggagaaaacatccttgaccgcgtagaaacaatccgcaaa
ttgtcgaagtcttcccgtgctggcaatgaagcagaccggcaggcgctgttaacaacactg
caaaacctttccaatgacgagctgctgccggtggcccgcgcgttcagccagtttctgaac
ctggccaataccgctgagcaataccacagcatttcgccgaaaggtgaagccgccagcaat
ccggaaattattgcccgcaccctgcgtaaactcaaagatcagcctgatatcaacgaaacc
gccatccgccaggccgtggaagcactgtcgctggaactggtgctcaccgcacacccgacc
gagatcacccgccgcacgctgatccataaaatggtcgaggtgaataactgcttaaaacag
ctcgatcataaagacatcgccgattacgagcgcaaccagatcacacgccgcctgcgccag
cttatcgcgcagtcctggcacactgacgaaattcgcaaaaaccggccaagcccggtggat
gaggccaaatggggcttcgccgttgttgaaaacagcctctgggaaggcgtaccaaactat
ttgcgcgaactgaacgaacagctcgaagcgcatctcgattacaaactgccggtggatttc
gtgccggtgcgcttcacctcctggatgggcggcgaccgcgacggcaacccgaacgtcacc
gccgatatcacccgtcacgttctgctgttgagccgctggaaagccaccgatctgttcctg
aaagatatccaggtgctcatttctgagttgtcgatggtcgagtgcagcgacgcgctgcgc
gaatatgtcggcaccgaaggcgcgcaggagccgtaccgttatctgctcaaagggctgcgc
gcgcagctgctcgccacccagggctggctggaagcccgactgaagggccagaagctgccg
aaaccgcaaggcctgctgacccagaacgaacagctctgggagccgctttacgcgtgttat
gagtcgctggtctcctgtggtcttggcattatcgccaacggcgaactgctcgacactctg
cgccgcgtcaaagcgttcggcgtgccgctggtgcgtatcgatatccgtcaggaaagcacc
cgccacaccgaagcgctcggcgagctgacccgctatcttggcatcggcgactacgaaagc
tggtcggaagccgataaacaggcgttcctgatccgcgagcttaactccaaacgtccgctg
ctgccgcgccagtgggagccgagcgacaacacccgcgaagtgctggaaacctgcaaagtc
atcgccgaagcgccgaaaggctcgatcgccgcgtatgtcatctccatggcgaaaacgcct
tctgacgtcctggccgttcacctgctgctcaaagaagcgggtatcggctttgcgctgccg
gtcgcgccgctgtttgaaaccctcgatgacctgaataacgctaacgacgttatgacgcag
ctgctgaatatcgactggtatcgcggctttattcagggcaaacagatggtgatgattggc
tattccgactccgcgaaagatgcgggcgtgatggccgcctcctgggcgcaataccaggcg
caggacgcactgatcaaaacttgcgagaaagcgggtatcgcgctgacgctgttccacgga
cgcggcggctctattggtcgcggcggcgcgccagcccacgcagcactgctctctcagccg
ccgggcagcctgaaaggtggcctgcgtgtaaccgagcaaggcgaaatgatccgcttcaaa
tatggcctgccggaagtgaccatcagcagcctgtcgctctacaccagcgctatccttgaa
gctaacctgttgccgccgccggagccggaagccgcctggcgtcacatcatggatgagctg
tctgacatctcctgcaccatgtaccgcggctacgtgcgcgaaaaccaagatttcgtgccc
tatttccgctccgccacgccggagcaggaacttggcaaactgccgctcggctcgcgtccg
gcgaaacgtcgcccgaccggcggcgttgaatcgctgcgcgccattccgtggatcttcgcc
tggacgcagaaccgcctgatgctgcccgcctggcttggcgcgggtgccgcgctgcaaaaa
gtagtggaagacggcaaacaggacgaactggaaaccatgtgccgcgactggccgttcttc
tccacccgtcttggcatgctggagatggttttcgccaaagcggatttgtggcttgcggag
tactacgatcagcgtctggtgaaaaaggaactctggccgctgggccaggagctgcgccag
ttgctggacgcggatatcaaagtggtgctggatatcgctaacgactcgcacctgatggcg
gatctgccgtggattgccgagtccatccagctacgtaacatctacaccgacccgctaaac
gtgcttcaggcagagctgctgcaccgctcgcgtcaggccgaagaagaaggtaaaccggca
gatgcgtgcgttgagcaggcgctgatggtcaccatcgcaggcgtagcggcaggcatgcgc
aacaccggctaa

DBGET integrated database retrieval system