KEGG   Cronobacter condimenti: AFK62_03675Help
Entry
AFK62_03675       CDS       T04060                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ccon  Cronobacter condimenti
Pathway
ccon00473  D-Alanine metabolism
ccon00550  Peptidoglycan biosynthesis
ccon01100  Metabolic pathways
ccon01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccon00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AFK62_03675 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AFK62_03675 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AFK62_03675 (ddl)
Enzymes [BR:ccon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AFK62_03675 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ccon01011]
 Precursor biosynthesis
  Amino acid ligase
   AFK62_03675 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATP-grasp_3 ATP-grasp Csa1 TTL ATPgrasp_ST ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ALB61658
UniProt: K8AHI1
LinkDB All DBs
Position
802800..803720
Genome map
AA seq 306 aa AA seqDB search
MAEKIAVLLGGSSAEREVSLQSGSAVLAGLKDAGVDAYAIDPRDICVTTLKEEGFDKVFI
ALHGRGGEDGTLQGTLEYLGLPYTGSGVMASAITMDKLRTKLLWQGAGLPVAPWVALERR
DIVNGLSETQKARIAALGLPVIVKPSREGSSVGMSKVDSADALTHALELAFEHDSEVLVE
KWLSGPEFTVAILGEEILPSIRIQPAGVFYDYEAKYLSDETQYFCPAGLDADREQALQAL
VMKAWRVLGCRGWGRVDVMQDSDGEFYLLEVNTAPGMTSHSLVPMAARQAGMSFPQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaaatcgccgtattgctgggcggcagctcggcggagcgtgaggtgtcgttg
cagtcaggtagcgccgtgctcgcaggtctgaaggatgctggcgtggatgcatatgcgatt
gatccacgcgacatctgcgtcacgacgctgaaagaagaaggattcgataaagtctttatc
gcgctacacggtcgcggcggtgaagatggcacactgcaagggacgctggagtatctcggg
ctgccctacaccggcagcggcgtaatggcgtcggccattaccatggataaactgcgcacc
aaactgctctggcagggcgcaggattgcctgtcgcgccgtgggtagcgctggagcgtcgc
gatatcgttaacgggctgagcgaaacgcagaaagcacgtatcgccgcgctgggcctgccg
gttatcgtaaagccgagccgtgaaggctcaagcgtcggtatgtcgaaggttgatagcgct
gatgcgttaacgcatgcgcttgaactggcgttcgaacatgacagcgaagtactggtcgaa
aaatggctgagtgggccggaatttaccgtcgccatactgggcgaggagattctgccctcg
atacggattcagcccgccggcgttttttatgattacgaggcgaagtatctctctgacgag
acacaatatttctgcccggctggccttgatgccgaccgtgaacaggcattgcaggcactg
gtgatgaaagcctggcgtgtgttgggttgccgtggttggggccgtgtagatgtgatgcag
gacagcgatggtgagttttatctgctggaggtaaatacggcgccgggtatgaccagccat
agtcttgtgccgatggcggcgcgtcaggcgggcatgagcttcccgcagctggtcgtgcgt
attctggagctggcggactga

DBGET integrated database retrieval system