KEGG   Cronobacter condimenti: AFK62_05670Help
Entry
AFK62_05670       CDS       T04060                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ccon  Cronobacter condimenti
Brite
KEGG Orthology (KO) [BR:ccon00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AFK62_05670
Enzymes [BR:ccon01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AFK62_05670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 DAO NAD_binding_8 K_oxygenase AlaDh_PNT_C FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ALB62019
UniProt: K8AGF0
LinkDB All DBs
Position
1241859..1243424
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLERLTKPVELVATLDDSAKSVEIKALLTEIAELSDKVSFREDNSLAA
RKPSFLITNPGSTQGPSFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGAVFQNEITERNVMGVPAVFMNGVE
FGSGRMTLAEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDTQSATKLIPAASEG
GLHQIETASGAVLKARSVIVATGAKWRNMGVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAMTTEVKGD
GTKLTGLDYQDRETGSVKHLEVAGIFVQIGLLPNTTWLDGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcaaggcttatcttgagcgtctgacaaagcct
gttgagttagtagccacgctggatgacagcgcaaaatcagtagaaatcaaagcgctgctg
accgaaatcgctgagctgtctgataaagtctctttcagagaagacaacagcctggcggca
cgtaaaccttcatttttgattacgaacccgggttccacccaggggccaagctttgctggc
tccccgctgggtcacgagtttacctcgctggtgctggcactgctgtggaccggcggtcat
ccgtcgaaagaagcgcaatctttgcttgagcagatccgcgatctcgacggcgatttcgaa
ttcgaaacgtactactcgctctcttgccataactgcccggacgtggtgcaggcactgaac
ctgatggcggtactgaacccgcgcatcaagcacactgcaattgacggtgcggtattccag
aatgaaattaccgagcgcaacgtcatgggcgtgccggcggtctttatgaatggcgttgag
ttcggctccggccgtatgacgcttgcggaaatcgtggcgaaagtcgacaccggtgctgaa
aaacgcgccgcagaagagctgaaccagcgtgacgcgtatgacgtactgatcgtcggctcc
ggcccggcgggtgcggcggcggcagtgtactctgcccgtaaaggcatccgtaccggtctg
atgggtgagcgtttcggcggtcaggtgctggacaccgtagacatcgaaaactacatctct
gtgccgaaaaccgaaggtcagaaactggcgggcgctctgaaagcgcacgtggatgactac
gacgttgatgttatcgacacccagagcgcgacgaagctgattccggcggcgagcgaaggc
ggcctgcatcagattgaaacggcctctggcgcggtgctgaaagcgcgcagcgttatcgtg
gcgaccggcgcaaaatggcgcaacatgggcgtgcctggcgaagatcagtatcgcacgaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaagcgtgtggcggtc
atcggcggcggtaactccggcgtggaagcggctatcgaccttgcagggatcgttgagcat
gtgacgctgctggaattcgcaccggaaatgaaagcagaccaggttctgcaggacaaactg
cgcagcctgaaaaacgtcgacatcatcctgaacgcgatgaccaccgaagtgaaaggcgat
ggcacgaagctgaccgggcttgattaccaggaccgtgagaccggctctgtgaagcacctg
gaagtggcggggatcttcgtacagattggtctgctgccgaacaccacctggcttgatggc
gcaattgagcgtaaccgcatgggcgaaatcatcatcgatgccaagtgcgaaaccagcgtg
aaaggcgtgttcgcggcgggtgactgcaccaccgtgccgtacaaacagattatcatcgcc
accggcgaaggcgcgaaagcgtcgctgagtgcctttgattacctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system