KEGG   Cronobacter condimenti: AFK62_08980Help
Entry
AFK62_08980       CDS       T04060                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ccon  Cronobacter condimenti
Brite
Enzymes [BR:ccon01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AFK62_08980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ALB62622
LinkDB All DBs
Position
1955734..1956252
Genome map
AA seq 172 aa AA seqDB search
MKRLTLAAMALLVCGAAQAASEEVDMRLVTDKGIGESVGTVKITETDHGLEFAPDLKGLP
PGDHGFHIHAKGSCEPAMKDGKMVAAEAAGGHLDPQNTGKHLGPEGNGHLGDLPVLAVNN
DGKATDTVTAPRIKKLDEVKGKALMVHVGGDNMADHPKPLGGGGGRYACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattgactctggcggcgatggcgctgctggtttgcggagcggcacaggccgcc
agcgaagaagtagatatgcgcctcgtcaccgataagggcatcggcgagtccgtcggtacg
gtgaaaatcaccgaaaccgaccacgggttagaattcgcgcccgacctgaaagggttgccg
ccaggcgaccacggttttcacattcacgccaaaggcagctgcgagcctgcgatgaaagac
ggcaaaatggtggcggctgaagcggcaggtggccatctcgacccgcaaaacaccggcaaa
cacttaggcccggaagggaacggccacctgggcgacctgccggtgcttgctgttaacaat
gacggaaaagccaccgacacggtaacggcaccgcgtatcaaaaagcttgatgaagtcaaa
ggcaaggcgctgatggtacacgttggtggtgataacatggccgatcatcctaaaccgctt
ggcggtggtggtggccgttacgcctgcggcgttatttaa

DBGET integrated database retrieval system