KEGG   Cronobacter condimenti: AFK62_18525Help
Entry
AFK62_18525       CDS       T04060                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ccon  Cronobacter condimenti
Pathway
ccon00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccon01100  Metabolic pathways
ccon01110  Biosynthesis of secondary metabolites
ccon01130  Biosynthesis of antibiotics
ccon01230  Biosynthesis of amino acids
Module
ccon_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ccon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AFK62_18525 (aroK)
Enzymes [BR:ccon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AFK62_18525 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 dNK Cytidylate_kin AAA AAA_16 AAA_22 APS_kinase TsaE ABC_tran AAA_7 AAA_17 AAA_5 Ploopntkinase3 MMR_HSR1 RNA_helicase AAA_PrkA His_biosynth AAA_28 AAA_25 AAA_29 RsgA_GTPase PduV-EutP Mg_chelatase GTP_EFTU AAA_24 AAA_14 AAA_2 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: ALB64376
LinkDB All DBs
Position
complement(4014140..4014661)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDTPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLENN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgctggcaaaagcactatt
gggcgtcagttagcacaacagctcaacatggaattttacgactccgaccaggagatcgaa
aaacgtaccggagctgatgtcggctgggtcttcgatgtagaaggcgaagaaggtttccgt
gatcgcgaagaaaaagtcatcaatgagctgacggaaaaacagggtattgtactggcgacc
ggcggtggctctgtcaaatcccgcgaaacccgcaatcgtctctccgcgcgtggcgtggtg
gtctatctggaaaccactatcgaaaagcagctcgcccgtacacagcgtgataaaaaacgc
ccgctgttacaggttgatacgccgccgcgtgaagtgcttgaagcgctcgctaatgagcgt
aatccgctgtacgaagaaattgccgacgtaacgatccgcactgatgatcagagcgcgaaa
gtggtggctaaccagattattcatatgctggaaaacaactga

DBGET integrated database retrieval system