KEGG   Cronobacter condimenti: AFK62_18555Help
Entry
AFK62_18555       CDS       T04060                                 

Gene name
mrcA
Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ccon  Cronobacter condimenti
Pathway
ccon00550  Peptidoglycan biosynthesis
ccon01100  Metabolic pathways
ccon01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ccon00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AFK62_18555 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AFK62_18555 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccon01003]
    AFK62_18555 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccon01011]
    AFK62_18555 (mrcA)
Enzymes [BR:ccon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AFK62_18555 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AFK62_18555 (mrcA)
Glycosyltransferases [BR:ccon01003]
 Polysaccharide
  Bacterial polysaccharide
   AFK62_18555 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:ccon01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AFK62_18555 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ALB64381
UniProt: K8A074
LinkDB All DBs
Position
4018441..4020996
Genome map
AA seq 851 aa AA seqDB search
MKFVKYLFFLAVFCILLGAGSIYGLYKFIEPQLPDVATLKDVRLQIPMQVYSADGELIAQ
YGEKRRIPLTLNQIPPEMVKAFIATEDSRFYDHHGVDPIGIFRAASVALFSGHASQGAST
ITQQLARNFFLSPERTLMRKIKEAFLAVRIEQLLTKDEILELYLNKIYLGYRAYGVGAAA
QVYFGKTVDQLSLSEIAVIAGLPKAPSTFNPLYSLDRATARRNVVLSRMMSEGYISQSQY
DDARSEEINANYHAPEIAFSAPYLTEMVRQEMISRYGENAYEDGYKVYTTITRRVQQAAQ
KAVRDNVMDYDMRHGYRGPSNVLWRVGEMAWDDKKITDSLKNLPTYGPLLPAVVTSANTD
EATALLADSSTVSLKMDGVRWARPYRSDTSQGPTPRRITDVLQAGQQIWVRKVDDNSWWL
GQVPDVNSALVSINPKDGSVLALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKG
LTLASILNDVPISRWDAGAGSDWRPKNSPPEYAGPIRLRQGLGQSKNVVMVRAMRAMGVD
YAAEYLQRFGFPAQNIVHTESLALGSASFTPLQVVRGYAVMANGGFLVDPWFISKITNAQ
GDPLFEAKPKIACPDCDIPVIYGETPKSDVLENKDVENVATSAEQQNAPVPMPQLEQANR
ELVAQSPAPQYAPHVISTPLSFLIKSALNSNIFGEPGWQGTGWRAGRDLQRRDIGGKTGT
TNSSKDAWFSGYGPGVVTSVWIGFDDHRRDLGRTTASGAIKNQISGYEGGAKSAQPAWDA
YMKAALEGVPEEPLTPPPGIVTVNIDRSTGQLANGGNSREEYFIEGTQPTQQAVHEVGTT
IIDNGETHELF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtatttattcttccttgcagtcttttgcattctgctgggagccggc
tcgatttatggtctgtataaatttattgagccgcagttgcccgatgtcgccacgctaaaa
gatgtgcggctccaaatccctatgcaggtgtatagcgccgacggtgaattgatcgcccag
tacggcgaaaagcgccgtattccgttgacgcttaaccaaatcccgcctgaaatggtgaaa
gcatttatcgccacggaagatagccgcttttacgaccaccacggcgttgatcccatcggg
attttccgcgccgcaagcgtggcgctgttctccggtcatgcctcgcagggcgcgagtact
attacgcaacagctggcgcgtaacttcttcttaagcccggaacgcaccctgatgcgtaaa
atcaaggaagcctttctcgcggtgcgtattgagcaactgctgacgaaagatgaaatcctt
gagctttacctgaataagatttacctcggctaccgcgcttacggcgtgggtgcggccgca
caggtctatttcggcaaaacggtcgaccagctctccttaagcgaaattgcggtcattgcg
ggtctgccgaaagcgccgtcgacatttaacccgctttactcactcgatcgcgcgacagcg
cgccgtaatgtggtgctgtcacgtatgatgagcgaaggctatatcagccagtcgcagtat
gacgacgctcgcagcgaagagatcaacgccaattatcacgcgccggaaatcgccttttcc
gcgccgtacctgaccgaaatggtgcgtcaggagatgattagtcgttatggcgaaaatgcc
tatgaggacggttataaggtctacaccacgatcacccgccgtgttcagcaggcggcgcag
aaagccgtacgcgataacgtcatggattacgatatgcgccatggctaccgcggcccgtct
aacgtgctgtggcgtgtcggtgaaatggcgtgggacgacaagaaaatcaccgattcgctg
aaaaacttgccgacctatggaccgctactgcctgcggtcgtcacttcagcgaacacggat
gaagccacggccctgctggcggacagttctacggtctcgttaaaaatggacggtgtacgc
tgggcccgcccgtaccgttcagatacgtcacaaggcccgacgccgcgccgcatcactgac
gtgctgcaggccggacagcagatttgggttcgtaaagtggatgacaacagctggtggctg
ggtcaggtgccggatgttaactccgcactggtctccattaacccgaaagatgggtcggtg
ctggcgctggtaggcggtttcgatttcaaccagagcaagtttaaccgcgcaacccaggcg
ctgcgccaggtaggctcgaatatcaagccgttcctgtacaccgcggcgatggacaaaggg
ctgacgctcgcaagcattctgaacgacgtgccgatttcccgctgggatgcgggtgccggt
tccgactggcgaccgaaaaactctccgccggaatatgcggggccaatccgcctgcgtcag
gggctggggcagtcgaaaaacgtggtgatggtccgcgcgatgcgcgcgatgggcgtcgac
tacgccgcggaatatttacagcgtttcggcttcccggcacagaatatcgtgcatacagaa
tcgctggcgcttggttccgcctccttcacgccgttgcaggtggttcgtggctatgcggtg
atggcgaacggcggttttctggtagatccgtggtttatcagcaaaatcaccaacgcccag
ggcgatccgttgtttgaggcaaaaccgaaaatcgcatgtccggattgtgatatcccggtg
atttacggcgaaacgccgaagtcggacgtactggaaaataaagatgtggaaaacgtcgcg
acctctgccgaacagcagaatgctccggtgccgatgccgcagcttgagcaggcaaaccgt
gaactggtcgcgcaaagtccggcgccgcagtacgcaccacacgtcatcagtacgccgctg
tcatttttgattaagagcgcgctgaacagcaacattttcggcgagccgggctggcaaggt
acgggctggcgcgcaggtcgcgatcttcagcgtcgcgatatcggcggtaaaaccgggacg
acgaacagctcgaaagacgcctggttctccggctacgggccgggcgtggtgacgtctgtc
tggataggctttgacgatcaccgccgcgatttgggtcgcaccacggcctccggcgcaatc
aaaaaccagatctctggctatgagggcggcgcgaaaagcgcacaaccggcgtgggatgct
tatatgaaagcggcgctcgaaggcgtgccggaagagccgttaacgccgccgccgggtatc
gtgacggtgaatattgaccgcagcaccggccaactggccaatggcggcaacagtcgtgaa
gagtatttcatcgaaggcacgcagccgacccaacaggccgtgcatgaagtcggtacaacg
attatcgacaacggggaaacccacgaactgttctaa

DBGET integrated database retrieval system