KEGG   Cronobacter condimenti: AFK62_18885Help
Entry
AFK62_18885       CDS       T04060                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ccon  Cronobacter condimenti
Pathway
ccon00250  Alanine, aspartate and glutamate metabolism
ccon00410  beta-Alanine metabolism
ccon00640  Propanoate metabolism
ccon00650  Butanoate metabolism
ccon01100  Metabolic pathways
ccon01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AFK62_18885
   00650 Butanoate metabolism
    AFK62_18885
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFK62_18885
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFK62_18885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccon01007]
    AFK62_18885
Enzymes [BR:ccon01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AFK62_18885
Amino acid related enzymes [BR:ccon01007]
 Aminotransferase (transaminase)
  Class III
   AFK62_18885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALB64445
UniProt: K8A325
LinkDB All DBs
Position
complement(4096515..4097780)
Genome map
AA seq 421 aa AA seqDB search
MKNSELNQRRQSATPRGVGVMCGFYAEKAENATLWDVEGNEIIDFAAGIAVLNTGHRHPR
IVEAIENQLRAFTHTAYQIVPYESYVSLAERINACAPINGPAKTAFFTTGAEAVENAVKI
ARAYTRRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVFHAQYPNALHGVSVD
DAMASLDRIFKADIAPDQVAAIVLEPVQGEGGFNVAPPAFMQALRALCDEHGILLIADEV
QTGFARTGKLFAMEHYSVKPDLLTMAKSLAGGMPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEHLCQRANELGQHLKEVLNQARTHCPAIAEVRGQGSMVAVEFND
PHTGKPSPSFTQEVQARAREEGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALEILSRALG
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaattcagaattgaatcaacgtcgtcagagcgccaccccacgtggcgttggcgtg
atgtgcggcttttatgccgaaaaagccgaaaacgccaccctgtgggacgtggaaggcaac
gagattatcgactttgcggcaggcatcgcggtgctaaacaccggtcatcgtcatccgcgt
atcgtggaggctatcgaaaatcaactgcgcgcctttacccacacggcgtaccagattgtg
ccgtacgaaagctatgtatcgcttgccgagcgcatcaatgcgtgcgcgcccattaatggc
ccggcgaaaaccgcgttcttcacaaccggcgcagaagccgtcgaaaacgcggtgaaaatc
gcccgcgcgtatacccgtcgcccagggctgattacttttggcggcggtttccatggccgc
acatttatgacgatggcgctcaccggcaaggtcgcgccgtacaaaatcggcttcggcccg
ttcccgggctcggttttccatgcccagtacccgaatgcgctgcacggcgtgtcggtggat
gatgcgatggcgagcctggatcgcattttcaaagccgatatcgcaccggatcaggtggcg
gcgattgtgctggagccggtgcagggcgaaggaggctttaacgtggcgccgccggcgttt
atgcaggcgctgcgtgcgctgtgtgacgagcacggcattctcctgattgccgatgaggtg
caaaccggctttgcgcgcaccggcaagctattcgcaatggagcactacagcgtgaagcct
gacctgctgacaatggcgaaaagccttgcaggcggaatgccgctctccggcgttgttggt
cgcgcagaggtgatggacgcgccagccccgggtggccttggcgggacgtatgcgggcaac
ccgctggctgtcgcggccgcgcacgcggtgctggatgtcatcgatgaagaacacttgtgc
cagcgcgcaaacgagctgggccagcacctgaaagaggtgctcaaccaggcgcgtacgcat
tgcccggccatcgccgaggtgcgcgggcaaggttcaatggtggcggtggagtttaacgat
ccgcacaccggcaaaccgtcgccgtcgtttacccaggaagtgcaggcccgcgcccgcgaa
gaggggctgctgctgctgagctgcggcgtttacggcaacgttatccgcttcctttacccg
ttaaccatcccggatgcgcagttcagcaaagcgctggagatcctctcccgcgcgctgggg
cggtaa

DBGET integrated database retrieval system