KEGG   Campylobacter coli OR12: ATE51_00634Help
Entry
ATE51_00634       CDS       T04527                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
ccoo  Campylobacter coli OR12
Brite
KEGG Orthology (KO) [BR:ccoo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ATE51_00634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ALU98857
UniProt: A0A0Q2IXS9
LinkDB All DBs
Position
complement(318533..319297)
Genome map
AA seq 254 aa AA seqDB search
MGFEHLDTIYYFVLFFVALFAGFIDSIVGGGGLITLPALIACGIPAHLSLATNKLQSVFG
SFTATLTYFKSTTLPHLAYGIFFTALGAAIGSYSVLFVKDEHLKLIILIFLTLTFLYTAL
RPSLGKHESEAKIKNIKFFHLICGLTLGFYDGFLGPGTGSFWIFACVMLLGFNMKKASIN
TKILNFTSNVVALFIFLWRYELLWIVGLLMGVGQILGAYLGSKLVLKTNGKFIKTLFLIV
VGATIIKVAWDYFS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggctttgaacatctagatacgatttattattttgtattgttttttgtagctcttttt
gcaggatttattgattctattgtgggtggaggtgggcttatcacacttcctgcgcttata
gcctgtggaattcctgcacatctttctttggcaaccaataaactccaaagtgtctttggc
tcttttacagcgactttaacttattttaaatcaaccaccctacctcatcttgcttatggt
atttttttcacagccttaggcgcagccataggaagttacagcgtgctttttgtaaaagat
gagcatttaaaacttatcattttgattttcttaactttgacttttttatacactgctttg
cgtcctagtttgggtaaacacgagagtgaagcaaagataaaaaatatcaaattttttcat
ttaatttgtggtttaactttgggtttttatgatggttttttagggcctgggacgggttca
ttttggatttttgcttgcgtaatgctactgggttttaatatgaaaaaagcaagtattaat
acaaaaattctaaatttcaccagcaatgtcgttgctctttttatctttttgtggcgatat
gaacttttatggatagtaggtttgcttatgggtgtaggacaaattttaggggcctatctt
ggttcaaaattagtacttaaaaccaatggcaaatttataaaaaccttgtttttaatcgtc
gtaggtgctactatcatcaaggttgcttgggattatttttcttaa

DBGET integrated database retrieval system