KEGG   Chondrus crispus (carragheen): CHC_T00006560001Help
Entry
CHC_T00006560001  CDS       T02916                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ccp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CHC_T00006560001
Enzymes [BR:ccp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CHC_T00006560001
Transporters [BR:ccp02000]
 Other Transporters
  Pores ion channels [TC:1]
   CHC_T00006560001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 17327037
NCBI-ProteinID: XP_005719318
UniProt: R7QLM8
LinkDB All DBs
AA seq 549 aa AA seqDB search
MKEADGIPWSALVQAYYLPRSRDNCCIKLAAAATKRYSSTTATRPALRLSIIPPPRRSLS
DRPRPNWWPRSSKKTTEKPKYRFPVPPPSHRLPAFRHLHSTPTAPRSRITSSLPAPAQRF
NAGATLRPLLLPPGHAPSVSAPVPAAPWEKLLARASPDDFVNGPNLISPTKERESLRLFS
QKDADVRLVLYRDHACWCPYCHKVQLLLEAKKVPYMVKKVNMSCYGSKPAEFLKIVPTGL
LPVIQLDGTIITESMDIMFLLEDTFQTPYRQMIPVDDNDMMQAFHRYMRLERVFTGSWLG
ALRGAMSSLGRGLEPVNHTLDLIETCLGDFEGSFFYPGPEPSFVDINFSTIFERARSSLK
FWRNLELADGRPNLRRWFAAWDAWEPATYLQSDDWTHIGALPPQIGPVSFLRTRSPVSLA
VETARSKHVLNDGHEGAQHRKQAANAICRNHAAVTKDAMRGVKGCPDEFHSVTDFAFRVL
SEVLLDPSKLEEAEIRVRETVKTEEWVMLGHALRFERVRCCSPRDMPIRAMEQFCGAINW
MLRTIEQEL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcagatgggatcccgtggagtgcgttagttcaagcttattatctgccgcga
tctcgtgacaattgctgcataaaactggctgcagccgctacgaaacggtactcgagtacc
accgctacgcggcccgcactccgcctctcgatcataccgcccccgcggaggtctctctct
gaccgtccacgtcccaactggtggccacgctcatcaaaaaaaacaaccgaaaaaccaaaa
tatcgttttcccgtcccgccgccctcgcatcgcctccctgccttccgtcatctccactcc
acccccaccgccccccgctcccgcatcacctcttctctccccgcgcccgcccagcgcttc
aatgccggcgccactcttcgtccactcctccttcctcctggtcacgccccctccgtgtca
gcgccagtgcccgccgcgccgtgggaaaagctgttggcccgcgcctcccccgacgacttt
gttaacggccccaacctcatctcgcccaccaaggagcgcgagtcgctccgcctcttctcg
cagaaggacgccgacgtccgcctcgtcctctaccgcgaccacgcctgctggtgcccctac
tgccacaaggtccagctcctgctcgaggcaaagaaggtcccctacatggtcaagaaggtc
aacatgagctgctacggctccaagcccgccgagtttctcaagatcgtcccgaccggcctg
ctcccggtcatccagctggacggcacgatcatcaccgagtccatggatatcatgttcttg
ctggaggacacgtttcagacaccgtaccgccagatgattccggtcgatgataacgacatg
atgcaggcctttcaccgctacatgcgcctcgagcgcgtcttcaccggctcgtggctcggt
gccctgcgaggcgccatgtctagcctcgggagaggcctggaaccggtcaaccacaccctc
gatctcatcgagacctgcctcggcgactttgagggctccttcttttacccgggcccggag
ccctcgttcgtcgacatcaatttctccacgatcttcgagcgcgcgcgctcctctctcaag
ttctggcgcaacctggagctagccgacggccgcccgaacctacgccgctggtttgccgcg
tgggacgcctgggagcccgccacgtacctgcagagcgacgactggacccacatcggcgcc
ctgccgccgcagatcggtccggtgtccttcctgcgcacgcggagcccggtgtcgctggcc
gtcgagacggcccgcagcaagcacgtgctcaacgatggccatgagggcgcccaacaccgt
aagcaggccgccaacgccatctgccgcaaccacgccgctgtcacgaaggacgccatgcgc
ggcgtcaagggatgcccggacgagtttcatagcgtcacggactttgctttcagggtgctt
agcgaggtcctgttggacccgtctaaactggaggaggcggagatccgggttagggagact
gttaagaccgaagaatgggtcatgcttggacatgctcttcggtttgaacgagtgagatgc
tgctcgccgagggatatgcccatcagggccatggagcagttttgcggagccatcaactgg
atgttgaggacgatcgagcaggagctgtag

DBGET integrated database retrieval system