KEGG   Chondrus crispus (carragheen): CHC_T00008437001Help
Entry
CHC_T00008437001  CDS       T02916                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp00620  Pyruvate metabolism
ccp00710  Carbon fixation in photosynthetic organisms
ccp01100  Metabolic pathways
ccp01200  Carbon metabolism
Module
ccp_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ccp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHC_T00008437001
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CHC_T00008437001
Enzymes [BR:ccp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CHC_T00008437001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 MerR-DNA-bind
Motif
Other DBs
NCBI-GeneID: 17320660
NCBI-ProteinID: XP_005712946
UniProt: R7Q5N1
LinkDB All DBs
AA seq 948 aa AA seqDB search
MKGVNPLLKSDSVDFISPLQADVSHLCDTLFSLIEKSCPPATIALLGNVKTLAKIYDVSS
KDDKAFANLANLIESLSVDQLTIIGSLFSNMCNLANLAEHVHRIRRRKAFDRGESSFLSR
HSLEEIVDDLQRNGFSLHQIRDQICSQTVEMVLTAHPTQAVRRSILAKLHDIAKIIEASH
DAYLTPEQSRINEELLKANLLCLWRTDEVRRSKPKPEDEARNIIHVIEETAWHATPIYIS
RMDHFFIKNGLKPIPLHATPFVFGSWAGGDRDGNPFVTPDVTVEVVNINRYRAACLYLAE
IESLLFDLSIHYGSDELLDYNKKIAKQTDQAAKSRPDLNVTTKIKYKEFWNYVPPKEPFR
VCFSYIRDRMTATRDHCEALLSNMPPPQSNPAAPIYTTKDELLEPLNIMYRSLVDTGDEI
IADGKLKDLIRRVHIFGLTIVKLDIRQEAEEHTNALDFITRYIGLGSYAEMDEDQRIKFL
TENLEGKRPLIPRAHSATGKAKNVLDTFEVVSDLGPEALGAYIISMCMKPSDVLAVEVLQ
RECSSNCGESSLRVVPLLETINALQDSAMVLGTLFENKWYRKHLERRFDSVQEVMVGYSD
SGKDGGRLTSAWELYKAQEHMVECAAKHGVTLRFFHGRGGTVGRGGGPQHLAILSQPPGT
VNQYLRVTIQGEVMEQDFGLPNLALRTLETYTTAVLKADLTEPVVVKPEYRELLDKLSEV
SCTKYREIVHGDPRFVQYFRSSTPEQELGLLNIGSRPQKRKEGGVETLRAIPWVFAWTQT
RLHLPVWLGLGSALQTGMNEAGGKQLLREMYEKWPFFRSFFDLIGMVLAKADPHISSRYE
DVLVEEEEQKQFGSMLRDLLVETIDLVLQVSGEQRLLDKDRVQQRAIETRLEWLTPMNLA
QVELLKRWRSVSVKGVVKPEVDQLKANQLVDALVISMKGLSSALQNTG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcgtcaacccccttctcaaaagcgactcagtcgacttcatctcccccctccag
gccgatgtctcccatctctgcgacaccctcttctccctcattgagaagagctgtccccct
gccaccatcgccctcctcggcaacgtcaaaaccctcgccaagatctacgacgtctccagc
aaggacgacaaggcctttgccaacctcgcaaacctcatcgaatccctctcggtcgaccag
ctcaccatcatcggctccctcttctccaacatgtgcaacctcgccaacctcgccgagcac
gtccaccgcattcgtcgccgaaaggcctttgatcggggcgagtcctcatttctttcgcgt
cactccctcgaagaaatcgtcgacgacctccaacgcaacggcttttcgctccaccagatt
cgcgaccagatctgctcccagaccgtcgagatggtcctcaccgcacaccccacccaggcc
gtccgtcgctctattctcgcaaagcttcacgacatcgcaaaaatcatcgaagccagtcat
gatgcttatcttacaccggagcagagtcgtatcaatgaggagcttctcaaagcaaatctc
ctttgcctgtggcgcacagacgaggtccgtcgttccaagccaaaaccagaggatgaggct
aggaatattatccatgtcatcgaggagaccgcttggcatgccacccctatctatatctcc
cgaatggatcacttttttatcaagaatggccttaagcctatccctctacatgcaactcct
tttgttttcggatcctgggctggcggcgaccgtgatggtaatccatttgttaccccggat
gtaacagtagaggtcgtcaatatcaatcgctaccgcgctgcatgcctctatcttgctgag
attgaaagcttgctctttgatctctcgattcactatggttccgatgaactcctcgactat
aacaagaagatcgccaagcaaaccgaccaagccgccaaatcacgtccggacctcaacgtc
accacaaagatcaagtacaaggagttttggaactatgtccccccgaaggaaccgtttcga
gtttgcttttcctacattcgcgaccgtatgaccgccacccgtgatcattgtgaagccttg
ctttccaatatgcccccgccccaatcaaacccagcagcccccatctacacgaccaaggat
gagctcctagagccgcttaacatcatgtatcgctccctggtcgacacaggggatgaaatt
attgccgatggaaaactcaaggatttaatccgtcgagttcacatctttggcctcactatt
gtcaaacttgacattcgtcaagaagccgaagaacataccaatgctctcgatttcattacg
agatacattggccttggcagctatgcggagatggatgaggaccagcgcatcaagttcctg
acagaaaatttggaagggaaaaggccccttattcctcgtgctcactctgccactggcaag
gcaaagaacgtactcgatactttcgaagtcgtctctgaccttggtcctgaggctcttggg
gcgtatatcatttcaatgtgcatgaagccatccgatgttctcgctgtggaagttcttcag
agggaatgctcaagcaattgtggtgagtcatctcttcgtgtagtacctcttttagagaca
attaatgctcttcaagattctgcaatggtgctgggcacactctttgagaacaaatggtat
cgcaagcaccttgagcgacgattcgactccgtacaagaggtcatggttgggtattcagat
agtggaaaagacggtggtcgactgacttctgcctgggagctgtacaaagcacaagagcat
atggtggaatgcgctgcaaaacatggagttactctccgattcttccatggtcgaggcgga
actgtcggacgcggaggcggtccccaacatctcgctattttgtctcagcctccggggact
gttaaccaatatttgagggtgactatccagggagaagtcatggagcaggactttggactg
cctaaccttgccttgagaaccctggagacgtacacgactgcggttctcaaggcagatctc
actgagccagtagtcgtcaaacccgaatacagggaacttcttgataagctttcggaagta
tcttgcaccaagtaccgagaaatcgttcatggagatccgcgcttcgtacaatactttcgt
tcttcgactccagagcaagaattgggcctcctcaacatcgggtcaaggcctcaaaaacga
aaggaaggcggagtggaaacacttcgggccattccgtgggttttcgcttggactcaaact
cggctacaccttcctgtttggcttggtttgggatctgcattacaaaccgggatgaatgaa
gctggaggaaagcaattgctgagagaaatgtacgaaaagtggcctttcttccggtcgttt
ttcgatctcattgggatggtgctcgcaaaggctgatcctcatatttcgagtcgttatgag
gatgttctcgtggaggaggaggaacaaaagcaatttggtagtatgcttcgagatttactc
gtggaaacaatagatctcgtgttgcaggtatctggagaacagaggcttttggataaggat
cgcgtgcagcagcgagcaatcgagactcgtttggagtggttgactcctatgaatctagct
caagttgagcttctcaagcgatggagatctgtttcagtcaagggggttgtaaaaccagaa
gttgatcaactgaaagcgaaccaactcgtcgacgcactggttatttcgatgaagggattg
tcatcggctcttcagaataccggctag

DBGET integrated database retrieval system