KEGG   Chondrus crispus (carragheen): CHC_T00008840001Help
Entry
CHC_T00008840001  CDS       T02916                                 

Definition
(RefSeq) actin
  KO
K05692  actin beta/gamma 1
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ccp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CHC_T00008840001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ccp03021]
    CHC_T00008840001
   03019 Messenger RNA biogenesis [BR:ccp03019]
    CHC_T00008840001
   03036 Chromosome and associated proteins [BR:ccp03036]
    CHC_T00008840001
   03029 Mitochondrial biogenesis [BR:ccp03029]
    CHC_T00008840001
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ccp04812]
    CHC_T00008840001
   04147 Exosome [BR:ccp04147]
    CHC_T00008840001
Transcription machinery [BR:ccp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     CHC_T00008840001
Messenger RNA biogenesis [BR:ccp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     CHC_T00008840001
Chromosome and associated proteins [BR:ccp03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     CHC_T00008840001
    NuA4 complex
     CHC_T00008840001
  Chromatin remodeling factors
   BAF complex
    CHC_T00008840001
   PBAF complex
    CHC_T00008840001
   SWR1 complex
    CHC_T00008840001
Mitochondrial biogenesis [BR:ccp03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    CHC_T00008840001
Cytoskeleton proteins [BR:ccp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     CHC_T00008840001
Exosome [BR:ccp04147]
 Exosomal proteins
  Proteins found in most exosomes
   CHC_T00008840001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 17324979
NCBI-ProteinID: XP_005717262
UniProt: P53499 R7QI61
LinkDB All DBs
AA seq 373 aa AA seqDB search
MSKPAVVIDNGSGRCKTGIAGEDCPKAVFPAVIGKPKQKGIMVGTGQKDEYVGDAAMARR
GVLIIKYPLEHGIVTNWDDMEKIWSHAFYSELRVDPQEHPVLLTEAPLNPKANRERMTQI
MFESFNIPAFYVAIQAVLSLYASGRTSGIVLDSGDGVTHTVPIYEGYSLPHAVLRIDLAG
RDLTGWMAKLLMQRGYSFTTSAELEIVRDVKQQLCFVAEDYEKELANASSNSSLEKEYEL
PDGQVITVEAERFQCPEALFKPELLGIEMDGMHLTAFNSIMKTDIDIRKDLYSNIVMSGG
TTMFAGIASRVQKEIETLAPPSMKIKVIAPPERQYSVWIGGSILSSLSTFQQMWVSKTEY
DEMGPSVVHRKCF
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcccgcggttgtcatcgacaatggctctggtcgctgcaagaccggtatcgcc
ggtgaggactgcccgaaggccgtcttccctgcagttatcggcaagccgaagcagaaggga
attatggttggtactggccaaaaggatgaatacgtcggtgacgccgccatggcccgccgt
ggtgttctcatcatcaagtatccgcttgagcacggtatcgtcaccaactgggacgacatg
gagaagatctggtcccatgccttctactctgagcttcgtgtcgatccccaggaacatccc
gttctactaactgaagcccctctcaaccccaaggctaaccgtgaacgcatgactcagatc
atgttcgaatccttcaacattccggctttctacgtcgctatccaggctgtcctttccctc
tatgcctccggccgtacctccggtatcgttctggactcaggtgatggtgtcactcacact
gttcccatctatgagggttattccctacctcatgctgtgctccgtattgatctcgctggc
cgcgatcttactgggtggatggccaagcttctcatgcagcgcggctattctttcaccaca
tctgccgagctcgagattgtgcgtgatgtcaagcagcagttgtgcttcgttgctgaggac
tacgagaaggagctcgccaacgcctcctccaactcctccctcgagaaggaatacgaactt
ccggacggtcaggtcatcactgtcgaggctgagcgattccagtgcccggaggccctcttc
aagccggagctcttgggtattgaaatggatggtatgcatttgactgcctttaactccatc
atgaagaccgatatcgatattcgtaaggatctttacagcaacattgtcatgtccggtggt
actactatgttcgccggtattgcttcccgtgtgcagaaggagattgagaccctggccccg
ccgtccatgaagattaaggttattgccccgccggagcgccagtattccgtctggattggt
ggctccattttgtcatctctctccaccttccagcagatgtgggtgtctaagaccgagtac
gacgagatgggcccgtctgttgtccaccgcaagtgcttctaa

DBGET integrated database retrieval system