KEGG   Chondrus crispus (carragheen): CHC_T00008943001Help
Entry
CHC_T00008943001  CDS       T02916                                 

Definition
(RefSeq) succinate dehydrogenase (Complex II) flavoprotein subunit precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp00020  Citrate cycle (TCA cycle)
ccp00190  Oxidative phosphorylation
ccp01100  Metabolic pathways
ccp01110  Biosynthesis of secondary metabolites
ccp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CHC_T00008943001
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CHC_T00008943001
Enzymes [BR:ccp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CHC_T00008943001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 17319269
NCBI-ProteinID: XP_005711554
UniProt: R7QV80
LinkDB All DBs
AA seq 636 aa AA seqDB search
MLLRPFAGRLARAIAAAPVRATRALSTSTSKVGGYDVVDHETDVLVVGAGGAGLRATIGA
CEAGLRTANVTKLFPTRSHTVAAQGGINGALGNMTPDDWRWHMYDTVKGSDWLGDQDAIH
YMCREAPATIIELENYGVPFSRTEDGRIYQRAFGGQSLDFGKGGQAYRCAAAADRTGHAM
LHTLYGQALKHDAEFFVEYFALDLIMDPVDGSCRGVTALCMEDGSLHRFNAHATIIATGG
YGRAYFSATSAHTCTGDGNAMVARAGIPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGFL
KNSEGERFMERYAPSAKDLASRDVVSRSMTMEIREGRGVGPKKDHIHLHLDHLEPSVLAE
RLPGISETAKIFAGVDVTKEPIPVLPTVHYNMGGIPTNWRGEVVTVKDGDPNYVVPGLFA
AGEAACASVHGANRLGANSLLDIVVFGRATAMRCGEIIKPDTPVRPLPKGAGEEAIADMD
KVRYADGEIRTSAIREDMQKIMQDNAAVFRTQESLSQGCKLIDECYESFGKVKITDRDMI
WNTDMVETLELRNLLQNAVITMHGAEARKESRGAHAREDFTERDDEVWMKHTLGWVSSHE
EKKNSRGFAHIDYRPVVSKSLDDSEQEAFPPAKRVY
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgcttctccgcccctttgccggtcgtctagcgcgagcgattgcggccgcgcccgttcgc
gccactcgcgccttgtcgacgtcgacgtcaaaggtgggcgggtacgacgtggtggaccat
gaaacggacgtactggttgtaggcgcgggcggagccggcctgcgtgcgacgatcggcgcc
tgcgaggccggccttcgcaccgccaatgtgaccaagctcttcccgacccgctcgcacacg
gtcgccgcgcagggcggcatcaacggcgccttggggaacatgaccccggacgattggcgc
tggcatatgtacgataccgtcaagggttcagactggctgggcgatcaggatgccattcat
tatatgtgtcgggaggccccggccaccattatcgagctcgagaactacggcgtcccgttt
agtcgcaccgaggatggccgcatttatcagagggcttttggaggccagtcactggacttt
ggaaaggggggacaggcctatcgttgcgccgccgccgcggatcgcacaggtcatgctatg
ttgcatacactgtatggacaggcgctcaagcatgatgccgagtttttcgtcgagtacttt
gccttggatttaatcatggaccccgtggatggcagctgcaggggtgtaacggcgctatgt
atggaggacgggtctttacatcgcttcaatgcccatgctaccatcattgccaccggggga
tacgggcgcgcgtatttcagcgcaacatctgcacatacatgcacgggcgatggcaatgcc
atggttgcgcgagcaggcattccattgcaggatcttgaatttgtgcagtttcatccgacg
ggaatatacggggctggatgtctgattacagaggggtctcgtggggagggaggatttttg
aaaaactcggagggcgaacgtttcatggagcggtatgcgccctcagcgaaagatctcgct
tctcgggacgtggtgtcgcgctcgatgactatggagattcgtgaagggcgtggagtgggg
ccgaagaaggaccacattcatctgcatctcgaccatttggagccgtcggtgctcgccgag
cgattgcccggtatatctgaaacggccaagatctttgctggtgtggacgtgaccaaggaa
ccgatccccgtattgcccacagtgcattacaacatgggagggattccgacaaactggcgt
ggggaggttgtgacggtcaaggatggagatccaaactacgtggttccagggcttttcgca
gccggtgaggcggcatgcgccagcgtgcatggtgcgaatcggctcggtgcaaattccttg
ctcgacattgtggtatttgggcgggcaacggcgatgagatgcggagaaatcatcaaaccg
gacacgccagtgcggcctttacccaagggtgctggggaggaggcgatcgcggacatggac
aaggtgcggtatgcggacggagagattcggacgtctgcgattcgcgaggacatgcaaaag
atcatgcaagacaacgcggcggtgttccggacgcaagagtcgctgtcgcaagggtgcaag
ctaatcgatgagtgctacgagagctttggcaaggtgaaaatcacggaccgggacatgatc
tggaacacagacatggtagagacgctggagctgcgaaacctcctgcagaacgcggtgatc
acgatgcacggggccgaggcgcgcaaggagtcacgcggggcgcatgcccgcgaggacttt
acagagagagatgacgaggtatggatgaagcatacgctgggttgggtgtcgagccacgaa
gaaaagaagaactcgcgagggtttgcgcacatcgattaccggccggtggtttcgaagagc
ttggatgattcggagcaggaagcgttcccgccggcgaagcgggtgtattag

DBGET integrated database retrieval system