KEGG   Chondrus crispus (carragheen): CHC_T00009084001Help
Entry
CHC_T00009084001  CDS       T02916                                 

Definition
(RefSeq) fatty acid elongase
  KO
K10246  fatty acid elongase 3 [EC:2.3.1.199]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp00062  Fatty acid elongation
ccp01040  Biosynthesis of unsaturated fatty acids
ccp01100  Metabolic pathways
ccp01110  Biosynthesis of secondary metabolites
ccp01212  Fatty acid metabolism
Module
ccp_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ccp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    CHC_T00009084001
   01040 Biosynthesis of unsaturated fatty acids
    CHC_T00009084001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccp01004]
    CHC_T00009084001
Enzymes [BR:ccp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     CHC_T00009084001
Lipid biosynthesis proteins [BR:ccp01004]
 Elongase
  LCFA
   CHC_T00009084001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO DUF5090
Motif
Other DBs
NCBI-GeneID: 17326153
NCBI-ProteinID: XP_005718424
UniProt: R7QM39
LinkDB All DBs
AA seq 280 aa AA seqDB search
MQFLTAGFEDSSALFGGKGIARWLSDWRFQPNVTPFSYWAWPVGASVMYVLILFSLRHVM
ATRKALEFPRILFLHNITLCIASLFLGSWLTYTLADAFVNGLTAYQLVCSRQIYENGHMH
MIYYINMFFKVWEFLDTFLLVVRKKQVAFLHAYHHAATLILTWNQLMEHSSPQWVPIVIN
LWVHVLMYYYYAMSALRIRIWWKKYLTTLQICQFVIDVTIIGYAYFTFIRAGFDDTVCYG
TTTGALVGLGVLFSYLLLFVRFYFQTYSKPRSKESAKKVQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttctcaccgccggtttcgaagactctagcgccctcttcggcggtaagggcatt
gcaagatggctttccgactggcgtttccagccaaacgtcaccccattcagctattgggcc
tggccggtcggtgcttctgtcatgtatgtcttaattctattctccttgcggcatgtcatg
gccacgcgcaaggcgcttgaatttccccgcatcctcttcctgcacaatatcaccttatgt
attgcaagcctctttctcggctcttggttgacgtacacccttgccgacgccttcgtcaat
ggcttgacggcatatcaactagtctgctcgaggcaaatttacgaaaacggccacatgcac
atgatctactacatcaacatgttttttaaggtttgggaatttctagacacctttctcctc
gtcgtccggaaaaaacaagtcgcttttttgcacgcatatcatcacgccgccactctcatc
ctaacttggaaccagctcatggagcattcctccccgcagtgggttcccatcgtcattaac
ctttgggtacacgtactcatgtactactactacgccatgtccgctctgcgtatccgcatc
tggtggaagaagtatctcaccactctccagatctgccagtttgtcattgacgttaccatc
attggttacgcctacttcacgttcatccgcgctgggtttgacgatactgtttgctatggt
accacaactggagccttggtcggcctcggtgttctgttttcttatcttctactattcgtc
cgcttctacttccagacctattctaaacctcgctcaaaagaatcagccaaaaaggttcaa
taa

DBGET integrated database retrieval system