KEGG   Chondrus crispus (carragheen): CHC_T00009199001Help
Entry
CHC_T00009199001  CDS       T02916                                 

Definition
(RefSeq) Putative ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ccp  Chondrus crispus (carragheen)
Pathway
ccp03030  DNA replication
ccp03410  Base excision repair
ccp03420  Nucleotide excision repair
ccp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ccp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CHC_T00009199001
   03410 Base excision repair
    CHC_T00009199001
   03420 Nucleotide excision repair
    CHC_T00009199001
   03430 Mismatch repair
    CHC_T00009199001
Enzymes [BR:ccp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CHC_T00009199001
    6.5.1.6  DNA ligase (ATP or NAD+)
     CHC_T00009199001
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CHC_T00009199001
DNA replication proteins [BR:ccp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CHC_T00009199001
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CHC_T00009199001
DNA repair and recombination proteins [BR:ccp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CHC_T00009199001
   NER (nucleotide excision repair)
    Other NER factors
     CHC_T00009199001
   MMR (mismatch exicision repair)
    Other MMR factors
     CHC_T00009199001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase
Motif
Other DBs
NCBI-GeneID: 17318431
NCBI-ProteinID: XP_005710713
UniProt: R7QQL7
LinkDB All DBs
AA seq 534 aa AA seqDB search
MERFAELLDDLYFTNSTLAKETILSNYLRATPDPDRGWALAAIAGTLSFDLFKRNVIKSL
MMERMDPFLFDMSRHYVGEMSETVALAWPKSEDPVRLNRLPSLHEIIEEFQFRDKAGIQK
YLITLLDNMSPSQRWALLKLGTRGLRIGMSARSVKQTLAKMKGVDVDIIEAAWHGLTPPY
LDLFAWLDGTADLPDLSDVVTFSPVMLAHPIDVEKDLSRITPQTHQAEWKWDGIRVQVAA
NGKSGGAKEVKIFSRKGEDISGSFPDLIETVDFHGVIDGELLVKPGGEIGSFNDLQQRLN
KKKPAKTLMKKLPAHVIAYDLLDWQSENLRQEPLSRRRELLKSLIAAHPDGRFALSETLV
FENTDDLVSLREEAAQTGGLIEGLMIKDMSSVYVSGRPKHAWYKWKRDPFLLDAVLMYAR
RGTGKRSSFYSDYTFGLWGEDGTLLPIGKAYFGFTDEELKKIDNWVRSHKLQRFGPVQEV
EKELVFEVAFDAAQISKRHKSGYALRFPRIHRIRWDKPAAEADKIVNLAKLVGK
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtttcgcagaactcttggacgatctctatttcaccaattcaactctggcgaaa
gaaacaatcctctccaactatcttcgcgcgacacctgatcctgacagaggatgggcgctc
gccgcgattgccggtacgttgagttttgatcttttcaaacgcaatgtcatcaagtctctg
atgatggaacggatggacccgttcctgtttgatatgtctcgtcattatgtcggtgaaatg
agcgaaactgtcgcgctggcttggccaaaatctgaagatcccgtcaggctcaaccgtctt
cccagcctgcatgaaataatcgaggaatttcaattccgcgacaaagcgggcatccaaaaa
tatctgatcacgcttctggataatatgtctccgtcgcaaagatgggcgctattaaagctc
ggtacgcggggtcttcgtattggcatgtcggcccggtcggtgaaacaaactctggcaaag
atgaaaggcgtggatgttgatattattgaggcggcctggcacggattgacaccgccctat
ctcgatcttttcgcttggctcgacgggaccgcagacctgccggatttaagcgacgtcgtc
accttttcgccggttatgcttgcccatccgattgatgtcgaaaaagacctcagccgaatc
acccctcaaacccatcaggccgaatggaaatgggacggcatccgtgtccaagtcgccgcc
aatggcaaaagcggcggcgcgaaggaggtcaaaatattctcccgcaaaggcgaagatatc
tcaggcagctttccagacctgatcgagaccgtcgactttcacggcgttatcgacggcgag
ttacttgtaaaacccggcggagagatcgggtcattcaatgatctgcaacagcggcttaat
aaaaagaaacccgcaaaaaccctgatgaaaaaattacctgctcatgtgatcgcctatgat
cttctggactggcagtctgaaaacctgaggcaggaacccttgtcgcgccgtcgagagctg
ttgaaaagcctgattgcggcccaccccgacgggcgcttcgcactttcggagactctagtt
ttcgagaataccgacgacctggtctcactacgcgaagaagcggcacagacaggcggtctg
atcgaaggcctcatgatcaaagatatgagcagcgtctacgtgtccgggcggccaaaacat
gcttggtataaatggaaacgcgatcctttcctattggacgccgtcctgatgtacgctagg
cgcggtacgggcaaacgctcttcattttattcggattacacattcggtctgtggggagag
gacggcacccttctacctatcggaaaggcctatttcggcttcacggacgaggaattaaag
aaaatcgataattgggtgcgcagtcacaagctccaaagattcggccctgtccaagaggtt
gaaaaagagctcgttttcgaagtcgcctttgacgcagcgcaaatcagtaaaagacacaaa
tccggctatgctttaagatttccccgtatacacagaatccgttgggataaaccggccgcc
gaagcggacaaaatcgtgaacctcgcgaaattagttggcaaatag

DBGET integrated database retrieval system