KEGG   Campylobacter coli 15-537360: N149_0262Help
Entry
N149_0262         CDS       T02895                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ccq  Campylobacter coli 15-537360
Pathway
ccq00061  Fatty acid biosynthesis
ccq00780  Biotin metabolism
ccq01100  Metabolic pathways
ccq01212  Fatty acid metabolism
Module
ccq_M00083  Fatty acid biosynthesis, elongation
ccq_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ccq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    N149_0262 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    N149_0262 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccq01004]
    N149_0262 (fabZ)
Enzymes [BR:ccq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     N149_0262 (fabZ)
Lipid biosynthesis proteins [BR:ccq01004]
 Fatty acid synthase
  Component type
   N149_0262 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT_2 4HBT
Motif
Other DBs
NCBI-ProteinID: AGZ20743
LinkDB All DBs
Position
273972..274412
Genome map
AA seq 146 aa AA seqDB search
MIDVMKIQEILPHRYPFLLVDKITELKVGEVVRGYKNISISDHVFMGHFPGHPIYPGVLI
LEGMAQTGGVLAFESMDAKVDPKSKVVYFTGIDGAKFRNPVRPGDRLDYEMQVVKNRGNM
WIFKGQAFVDGNLVAEAELKAMIVDK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatagatgtaatgaaaattcaagaaattttacctcaccgttatccttttttgcttgtt
gataaaatcacagagttaaaagttggagaagttgttcgaggatataaaaatatcagcata
agcgaccatgtttttatgggacatttcccaggtcatcctatttatcctggagttttgatt
ttagaaggtatggcgcaaacgggtggggttttggcttttgaaagcatggatgctaaggta
gatccaaaaagtaaggttgtatattttacaggtattgatggagctaaatttagaaatcct
gttcgccctggagatagacttgattatgaaatgcaagtagttaaaaatcgtggcaatatg
tggatttttaagggtcaagcttttgtagatggaaatttggttgcagaagcagaacttaaa
gctatgatagtagacaaataa

DBGET integrated database retrieval system