KEGG   Campylobacter coli 15-537360: N149_1594Help
Entry
N149_1594         CDS       T02895                                 

Gene name
pfs
Definition
(GenBank) aminodeoxyfutalosine nucleosidase
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
ccq  Campylobacter coli 15-537360
Pathway
ccq00130  Ubiquinone and other terpenoid-quinone biosynthesis
ccq00270  Cysteine and methionine metabolism
ccq01100  Metabolic pathways
ccq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    N149_1594 (pfs)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    N149_1594 (pfs)
Enzymes [BR:ccq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     N149_1594 (pfs)
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     N149_1594 (pfs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: AGZ22004
LinkDB All DBs
Position
complement(1591506..1592192)
Genome map
AA seq 228 aa AA seqDB search
MKIAILGAMSEEITPLLETLKNYTKIEHANNTYYFANYKNHELILAYSKIGKVNSTLSAS
VMIEKFGAQVLLFTGVAGAFNPELEIGDLLYATKLAQYDLDITAFGHPLGFVPGNEIFIK
TDDKLNNLALEVAKELNIKLRAGIIATGDEFICDEAKKAKIREIFNADACEMEGASVALV
CDALKVPCFILRAMSDKAGEKAEFDFDEFVINSAKISANFVLKMCEKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaattttaggtgcaatgagtgaagaaatcactcctttgcttgaaacactt
aaaaattatacaaaaatagaacacgctaataatacttattattttgcaaactataaaaat
catgagcttattcttgcttattctaagataggcaaggtaaattctaccctaagtgctagc
gtaatgatagaaaaatttggcgcgcaagttttactttttacaggtgttgcaggagcgttt
aatcctgagcttgagattggtgacttgctttatgcgacgaaattagcacaatatgatctt
gatatcactgcttttggacatccattgggttttgttccaggaaatgaaatttttataaag
acagacgataaattaaacaatcttgctttagaagtcgcaaaagaattaaatatcaaactt
cgtgcaggtattatcgcaacgggtgatgaatttatttgtgatgaggcaaagaaagcaaaa
atcagagaaattttcaatgcggatgcttgtgaaatggaaggcgcaagtgtggctttggtt
tgtgatgctttaaaggtgccttgttttatcttaagagctatgagtgataaagccggcgaa
aaggctgaatttgattttgatgagtttgtgatcaattcagctaaaatttcggctaatttt
gtacttaaaatgtgtgagaaattatga

DBGET integrated database retrieval system