KEGG   Caulobacter vibrioides CB15: CC_1789Help
Entry
CC_1789           CDS       T00049                                 

Definition
(RefSeq) hypothetical protein
Organism
ccr  Caulobacter vibrioides CB15
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 942189
NCBI-ProteinID: NP_420597
UniProt: Q9A7D4
LinkDB All DBs
Position
1977665..1979143
Genome map
AA seq 492 aa AA seqDB search
MFVHLLSLDEQLGPAAAPRQMQPSASLQKHDAQPISSGGCHRPHGTSWRVFRSAGRELSP
GCAPRKTASQDGIGKGADDRRQAHQTQQRPVAFGAGLTIGGAGEEFPDRDDGRGVGELRS
EREGADRRGGAQRPGGRGDHRPVDQVETARAGAVDEAAQRHALGGDAPQGEEDQHARQRR
RRGQDGERPGTKSRRQPAPDTLRDHAAQGGGGQQDGGRGGGGQGERGVVGLKLVEQRGGR
RSHHAHGHGQDDGSAAEHLEDGDGAGRRQLGDVAAGREGQEDRAERGGQRQGRAGRDRGP
DRARLAQPRDQQPRQRRDQQGRDAAEHDPQAGQARAGAVGRRGQAQHRVLRHVDQRIGRA
KGQARDAGEGQSLVSGDNGGQREHHERDGASDGADELQASGGGGGTDMAAQNLGDHEVGN
GAEDQRRGQREARGAGVETTEFGEKEDEEQVAGVPEQALAQVRPGIGGGQGPRIAGVLRH
REFRRPHSSLDL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtccatctcctgtccctggacgagcagcttggaccggccgccgcaccgcgccaa
atgcagccatcggcttccctccagaaacatgacgctcagccaatcagctctggcggctgc
caccggccgcacggcacatcttggcgcgtctttcgttcagccgggcgcgagctctcaccc
ggttgcgcgcctcggaagacggctagccaggacggcataggcaaaggcgccgacgatcgg
cgccaggcacatcagacccagcagcggccagtggccttcggagccggtctgacgataggg
ggagcgggcgaggagttccccgaccgcgatgatggccgcggcgttggcgagcttcgaagc
gaacgtgaaggcgctgaccgtcgcggcggggcccagcggccgggcggccgcggcgaccac
cgtccagttgaccaggttgagaccgcccgtgccggcgccgtagacgaagccgcccagcgc
cacgccttggggggcgacgcgccccaaggcgaagaagatcaacacgcccgccagcgtcgt
cgccgcggccaagatggcgagcgcccggggaccaagtcgcggcgccagcccgctccagac
accttgcgagaccacgccgcccagggcggtggcggtcaacaggacggtggccgcggcggg
ggaggccagggcgaacgcggcgtagtagggctcaagcttgttgaacagcgtggtggacgc
cgcagccaccatgcccatggccacgggcaggacgacggctcggctgcggaacacctggag
gatggagacggcgccgggcgccgccaactcggcgacgtggcggctggccgcgagggccag
gaagatcgcgccgagcgtggcggccagcgccagggccgcgctggccgcgatcggggacca
gaccgcgcgaggctggcccagccccgcgatcagcagccccgccagcgccgagaccaacaa
ggacgcgacgccgctgaacacgatccgcaggccggccaggcgcgcgcgggcgcggtcggt
cgccgcggccaggcccagcatcgcgttctgcggcacgtcgatcagcgcataggccgcgcg
aaaggccaggctcgcgacgcaggcgaaggccagtctttggtcagcggtgacaatggcggt
cagcgagaacatcacgaacgtgatggcgcaagcgacggcgccgacgagctgcaggcgtcc
ggcggcggcggtggaactgatatggcggcccagaaccttggcgaccacgaggtcggcaat
ggcgctgaagaccagcgccgcggccagcgcgaggctcgcggcgcgggcgtcgagaccacc
gaattcggtgagaaagaagacgaagagcaggtcgccggcgtaccagaacaggctcttgcc
caggtgcgccccggcataggcggcggccaaggtccgagaatcgctggcgtcttgcgtcat
cgggagtttcgccgcccgcactcaagcctcgacctatga

DBGET integrated database retrieval system