KEGG   Caulobacter vibrioides CB15: CC_2543Help
Entry
CC_2543           CDS       T00049                                 

Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ccr  Caulobacter vibrioides CB15
Pathway
ccr00473  D-Alanine metabolism
ccr00550  Peptidoglycan biosynthesis
ccr01100  Metabolic pathways
ccr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CC_2543
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CC_2543
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CC_2543
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccr01011]
    CC_2543
Enzymes [BR:ccr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CC_2543
Peptidoglycan biosynthesis and degradation proteins [BR:ccr01011]
 Precursor biosynthesis
  Amino acid ligase
   CC_2543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_Ter
Motif
Other DBs
NCBI-GeneID: 940599
NCBI-ProteinID: NP_421346
UniProt: Q9A5A9
LinkDB All DBs
Position
complement(2749728..2750702)
Genome map
AA seq 324 aa AA seqDB search
MTQQPQADAPLAGRHIAVLLGGPSSERKVSLVSGAACAEALERLGAKVSRIDPGPDVAQV
LAATKPDMVFNALHGEWGEDGCVQGVLETLKLPYTHSGVLASALAMDKAKAKAVLAAAGV
TVPGGGLFNRHDVARDHVLQPPYVVKPNAEGSSVGVFIIKEGANRPPEEVGAPSWTFGEE
VMVEPYIQGMELAVAVLGESNGPRALAVTDIRASTGFYDYEAKYSEGGSIHVLPAPIPNA
VRDRAMRMAELAHTALGCRGVTRSDFRYDDINDLLVLLEVNTQPGMTPTSLAPEQADHVG
IPFDQLVLWIVEDAYARCSAGGTA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcagccccaagctgacgcccctttggccggccgccacatcgccgtcctgctc
ggcggcccctcgtcggaacgcaaggtcagtctggtgtcgggcgcggcctgcgccgaggcg
ctggagcggctgggcgccaaggtctcccgcattgatccaggcccggatgtggcccaggtg
ctggcagcgaccaagccggacatggtcttcaacgctttgcacggcgaatggggcgaggac
ggctgcgtccagggcgtgctggagacgctgaagctgccctacacccactcaggcgtgctg
gcctcggccctggcgatggacaaggccaaggccaaggctgtgctggccgcggccggcgtc
acggtgccgggcggggggctcttcaaccgacacgatgtcgcacgcgaccatgtgctgcag
cccccctatgtcgtgaagccgaacgccgaaggctcgtcggtgggcgtgttcatcatcaag
gaaggcgccaatcgtccgcccgaggaggtcggcgcgccgtcctggaccttcggcgaggaa
gtcatggtcgaaccctacatccaggggatggagctggcggtcgccgttctgggtgagtca
aatggtcccagagcgctggcggtgaccgatatccgtgcatccacaggtttttacgactac
gaagccaagtactctgaaggcggttcaatccacgtcctcccggccccaatccccaatgct
gtaagggatcgcgccatgcggatggccgagctggcccataccgctcttggttgccgaggg
gtaacccggtcggacttccgttatgacgacattaacgaccttctggtccttctagaggtc
aacacgcagcctggcatgacgccgacctcgctcgctcccgagcaggccgaccacgtcggg
atcccgtttgaccagttagttttgtggatcgtggaggacgcttatgcccgctgtagtgcg
ggggggaccgcctaa

DBGET integrated database retrieval system