KEGG   Caulobacter vibrioides CB15: CC_2843Help
Entry
CC_2843           CDS       T00049                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccr  Caulobacter vibrioides CB15
Pathway
ccr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CC_2843
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccr02000]
    CC_2843
Enzymes [BR:ccr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CC_2843
Transporters [BR:ccr02000]
 Other Transporters
  Pores ion channels [TC:1]
   CC_2843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 alpha-hel2
Motif
Other DBs
NCBI-GeneID: 941329
NCBI-ProteinID: NP_421639
UniProt: Q9A4I8
LinkDB All DBs
Position
3071295..3071957
Genome map
AA seq 220 aa AA seqDB search
MIIVHHLNNSRSQRVLWLLEELGLPYEIKRYQRDAKTMLAPPELRAIHPLGKSPVITDGD
TVLAETGAIVEYIIAMYGGGRLTPTAGTPERLRYTYWLHYAEGSAMPPLLMKLVFTALPA
RAPGLMRGVVKSIAARALKGFVDPQLKAHMDYWEAELAKSTWFAGAELTGADIMMSFPLE
TAAQRAGAAERPRIKAFLERIHARPAYQRALQRGGPYDYA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcattgttcaccatcttaacaattcgcgtagtcagcgggtgctttggctcctcgaa
gagctgggcctgccctacgagatcaagcgctatcagcgcgacgccaagaccatgctggcg
ccgccggagctccgggcgatccacccgctgggcaagtcgccggtgatcaccgatggcgac
acggtgctggccgagaccggcgccatcgtcgagtacatcatcgccatgtacggcgggggc
cgactgacgccgacggccggcacgcccgagcgcctgcgctacacctactggctgcactat
gccgagggctcggccatgccgccgctcttgatgaagctggtgttcacggccctgcccgcc
cgcgcgcccggcctgatgcgcggcgtggtcaagtcgatcgccgctcgggccctgaagggc
ttcgtcgatccgcagctgaaggcccatatggactactgggaggccgagcttgccaagtcg
acctggttcgcaggcgcggagctgaccggcgccgacatcatgatgagcttcccgctcgaa
accgccgcccagcgcgccggggccgccgagcggccaaggatcaaggcgttcctcgagcgt
atccacgcccgccccgcctatcagcgcgccctccagcgcgggggaccgtacgactacgcc
tga

DBGET integrated database retrieval system