KEGG   Caulobacter vibrioides CB15: CC_2919Help
Entry
CC_2919           CDS       T00049                                 

Definition
(RefSeq) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ccr  Caulobacter vibrioides CB15
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CC_2919
Enzymes [BR:ccr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CC_2919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 AlaDh_PNT_C FAD_binding_3 FAD_oxidored NAD_binding_7 K_oxygenase Glutaredoxin DAO FMO-like NAD_binding_8 Thi4
Motif
Other DBs
NCBI-GeneID: 940666
NCBI-ProteinID: NP_421713
UniProt: Q9A4B7
LinkDB All DBs
Position
3139983..3141566
Genome map
AA seq 527 aa AA seqDB search
MLDAGLKAQLTTYLQNLRQPITLVASLDDSKGSVDMRALLDDVASTSDKVSVRFDGDDAR
KPSFAIERAANDAEVRFAGLPLGHEFTSLVLALLHVGGHPPRIDAEVIERIKALDGDYQF
ETYFSQSCQNCPDVVQALNTMSALNPRIRHVAIDGALFKAEVEARQVMAVPTILLNGQAF
GQGRMEIEQILAKLDTGAADRMAEKIRAKDAFEVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMDIENFISVPHTEGPKLASALEQHVKDYEVDVMNLQKAVGLVPAKTPGG
LHEIKLENGANLKARTLILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVTIIKSAMTTEIHGDG
SKVNGLTYKDRTSDTAHRVDLEGVFVQIGLVPNTEWLKDSGVALSPRGEIEVDYRGETSI
PGVFAAGDATVTPYKQIIIAMGEGAKASLSAFDYLIRLPASEAAEAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccggtctgaaagcccaactgaccacctatctgcagaacctgcgccagccg
atcacgctggtcgcctcgctggacgactccaagggctcggtcgacatgcgcgccctgctg
gacgacgtcgcctcgacctccgacaaggtcagcgtccgcttcgacggcgatgacgcccgc
aagccctcgttcgccatcgagcgcgccgccaatgacgccgaagtgcgtttcgccggcctg
ccgctgggccacgagttcacctcgctggtgctggctctgctgcacgtgggcggccacccg
ccccgcatcgacgccgaggtgatcgagcgcatcaaggcgctggacggcgactatcagttc
gagacctatttctcgcagtcgtgccagaactgccccgacgtggtgcaggcgctgaacacg
atgagcgccctgaacccgcgcatccgccacgtcgccatcgacggcgccctgttcaaggcc
gaggtcgaggcgcgccaggtgatggccgtgccgaccatcctgctgaacggccaggccttc
ggccagggccgcatggaaatcgaacagatcctggccaagctggacaccggcgcagccgac
cgcatggccgaaaagatcagggccaaggacgctttcgaggttctggtggtcggcggcggc
ccggccggcgcagcggcggcgatctacgccgcccgcaagggcatccgcaccggtgtggcg
gccgaacgcttcggcggccaggtgctggacaccatggatatcgagaacttcatctcggtg
ccgcacaccgaaggccccaagctcgccagcgcgctggagcagcacgtcaaggactatgag
gtcgacgtgatgaacctgcagaaggccgtgggcctggtcccggccaagacgccgggcggc
ctgcacgagatcaagctggagaacggcgccaacctgaaggcccgcaccctgatcctgtcg
accggcgcccgctggcgcaacgtcaacgtgcccggcgaggccgagtacaagaacaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaacagcggcgtcgaggcggccatcgatctggcgggcatcgtcgcccacgtg
accctgatcgagttcgacagccaactgcgcgccgacgcggtgctccagcgcaagctggcc
agcctgccgaacgtgacgatcatcaaatcggccatgaccaccgagatccacggcgacggg
tccaaggtgaacggcctgacctacaaggatcgcaccagcgacacggcccaccgcgtcgac
ctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctgaaggactcg
ggcgtggccttgtcgccgcgcggcgagatcgaggtcgactatcgcggcgaaacctcgatc
cccggcgtcttcgccgccggcgacgcgacggtgacgccctacaagcagatcatcatcgcc
atgggcgaaggggccaaggcctcgctctcggcgttcgactacctgatccgcctgccggcg
tcggaggcggcggaagcggcgtag

DBGET integrated database retrieval system