KEGG   Caulobacter vibrioides CB15: CC_3610Help
Entry
CC_3610           CDS       T00049                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ccr  Caulobacter vibrioides CB15
Pathway
ccr03030  DNA replication
ccr03410  Base excision repair
ccr03420  Nucleotide excision repair
ccr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CC_3610
   03410 Base excision repair
    CC_3610
   03420 Nucleotide excision repair
    CC_3610
   03430 Mismatch repair
    CC_3610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ccr03032]
    CC_3610
   03400 DNA repair and recombination proteins [BR:ccr03400]
    CC_3610
Enzymes [BR:ccr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CC_3610
    6.5.1.6  DNA ligase (ATP or NAD+)
     CC_3610
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CC_3610
DNA replication proteins [BR:ccr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CC_3610
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CC_3610
DNA repair and recombination proteins [BR:ccr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CC_3610
   NER (nucleotide excision repair)
    Other NER factors
     CC_3610
   MMR (mismatch exicision repair)
    Other MMR factors
     CC_3610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-GeneID: 942882
NCBI-ProteinID: NP_422404
UniProt: Q9A2F5
LinkDB All DBs
Position
3866750..3868375
Genome map
AA seq 541 aa AA seqDB search
MSMRAFAHLLDRLSLTSSRNAKLILIQDHLRQTPDPDRGYALAALTGALSFNAAKPAFIR
KAIEARMDPQLFAWSYDFVGDLAETVSLVWPAPSSRKWLGANRPPELSEVIDALHSASRP
EVQRLIEGWLDALDPDGRWALLKLMTGGLRVGVSSRLAKQACANLGGVDIGEIEEIWHAL
APPYGDLFAWLEGRSERPSPDAPGRFRPVMLAQPLDEEVDFQKLDPADYLAEWKWDGIRV
QAVSERGERRLYTRTGDDISASFPDVVEALDFEGAIDGELLVLRDGALASFGDLQQRLNR
KTVDAKLLAAFPAGIRAYDLLMDGETDLRALPFETRRARLEAFVASLKTSRIDLSPLQPF
STWKALAALRLEPPEGDARLSEGLMLKRRDSVYEPGRPKGPWFKWKRDPRLIDAVLMYAQ
RGHGKRSSFYSDYTFGVWREDEDGRRTLTPVGKAYFGFTDEELKQIDKFVRDHTIERFGP
VRSVRADADVGLIFEVAFEGLQRSSRHKSGVAMRFPRINRIRWDKPAREADELATLEAML
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgcgcgccttcgcccatctgctcgatcggctgtccctgaccagttcgcgcaac
gccaagctgatcttgatccaggatcatttgcgccagacgcccgatcccgatcggggctat
gcgcttgcggccctgaccggcgcgctgtcgttcaacgccgccaagccggccttcatccgc
aaggccattgaggcgcggatggacccccagctgttcgcctggtcgtacgacttcgtcggc
gacctggccgagacggtctcgctggtctggcccgccccctcctccagaaaatggctgggc
gccaaccgcccaccggaactgtccgaggtcatcgacgccctgcattcggcctcgcgcccc
gaggtgcagcggctgatcgagggctggctggacgcgctggatcccgacggtcgctgggcg
ttgctgaagctgatgaccggcggactgcgggtcggcgtctcctcgcgcctggccaagcag
gcctgcgccaacctcggcggcgtcgacatcggcgagatcgaggagatctggcatgcgctg
gcgccgccctatggcgacctcttcgcctggctggaggggcgctccgaacgcccgtcgccc
gacgcgccgggccgcttccgcccggtgatgctggcccagccgctggacgaggaggtcgac
ttccaaaagctcgacccggccgactacctcgccgaatggaagtgggacggcatccgcgtg
caggcagtttccgaacgcggcgagcgccggctctacacccgcaccggcgacgacatctcg
gccagctttcccgatgtggtggaggcgctcgacttcgagggcgcgatcgacggcgaactg
ctggtgctgcgcgacggcgccctggcctcgttcggcgatctccagcaacgcctgaaccgc
aagacggtcgacgccaaactgctagccgcgttcccggccgggatccgggcctatgatctg
ctgatggacggcgagaccgacctgcgggccctgccgttcgagacgcgccgcgcccggctg
gaagcgttcgtcgccagcctcaagacctcgcgcatcgacctctcgcccctgcagcccttt
tcgacctggaaggcgctcgccgcgcttcgacttgaaccgcccgagggtgatgcgcgcctg
tccgaaggtctgatgctgaagcgccgcgacagcgtctacgaacccggccgccccaagggc
ccctggttcaagtggaaacgcgatccgcgcctgatcgacgcggtgctgatgtacgcccag
cgcggtcacggcaagcgatcgagcttctattccgactacaccttcggcgtctggcgcgag
gatgaggacggccggcgcaccctgacccccgtcggcaaggcctatttcggcttcaccgac
gaggagctgaagcagatcgacaagttcgtccgcgaccacacgatcgaacgcttcggcccc
gtgcgctcggtgcgcgccgacgcggacgtcggtctgatcttcgaggtcgccttcgaaggc
ctgcagcggtccagccgccacaagtccggcgtcgccatgcggtttccccgcatcaaccgc
atccgctgggacaagcccgcgcgcgaggctgatgagctagcgacgttggaagcgatgctg
gactga

DBGET integrated database retrieval system