KEGG   Caulobacter vibrioides CB15: CC_3717Help
Entry
CC_3717           CDS       T00049                                 

Definition
(RefSeq) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ccr  Caulobacter vibrioides CB15
Pathway
ccr00061  Fatty acid biosynthesis
ccr00780  Biotin metabolism
ccr01100  Metabolic pathways
ccr01130  Biosynthesis of antibiotics
ccr01212  Fatty acid metabolism
Module
ccr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ccr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CC_3717
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CC_3717
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CC_3717
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccr01004]
    CC_3717
Enzymes [BR:ccr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CC_3717
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CC_3717
Lipid biosynthesis proteins [BR:ccr01004]
 Fatty acid synthase
  Component type
   CC_3717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-GeneID: 942821
NCBI-ProteinID: NP_422511
UniProt: Q9A249
LinkDB All DBs
Position
complement(3972012..3972848)
Genome map
AA seq 278 aa AA seqDB search
MRKRAPHMADDYAFPKGELMRGKKGLVMGVANHNSIAWGIASQLAAQGAEMAFTYQGEEL
ERRVRPLAESIGVKTMIPCDVTDDASMDAAFAEIEKAFGTIDFVVHSVAFANKNELKGSF
VDNTTREGFLLAMNISAFSFVDVAKRASKLMPNGGSLITMTYLGSERTIPNYNTMGVAKA
ALEASTRYIARDLGPKGIRCNAISAGAMRTLALAGIAGGRGMIAQGRAFSAMKEDTSMEG
VAGCALWLASDLGKSTTGEVVHVDAGFHMMGMPDAEEA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaaagagggccccacacatggccgacgattacgcgttccccaagggcgagctgatg
cgaggcaagaagggcctcgtcatgggcgtggccaaccacaactcgatcgcctggggcatc
gccagccagctggccgcccagggcgccgagatggccttcacctaccagggtgaggaactg
gagcgccgcgtgcgcccgctggccgaaagcatcggtgtcaagaccatgatcccctgcgac
gtcactgacgacgcctcgatggatgcggccttcgccgagatcgagaaggcgttcgggacg
atcgatttcgtggtgcactcggtggccttcgccaacaagaacgagctgaagggctcgttc
gtcgacaacaccacgcgggaaggcttcctgctggccatgaacatctcggccttcagcttc
gtggacgtcgccaagcgcgcttccaagctgatgccgaacggcggctcgctgatcaccatg
acctatctggggtcggagcggaccatcccgaactacaacaccatgggcgtggccaaggcc
gcgctcgaggcctcgacccgctacatcgcccgggatctgggtcccaagggtatccgctgc
aacgccatctcggccggcgccatgcgcaccctggccctggcgggcatcgccggcggtcgg
ggcatgatcgcccagggccgcgccttctcggcgatgaaggaagacacctcgatggaaggc
gtcgccggctgcgccctgtggctggcctcggaccttggcaagtcgaccaccggcgaggtc
gtccacgtcgacgctggcttccacatgatgggcatgcctgacgccgaggaggcttaa

DBGET integrated database retrieval system