KEGG   Chondromyces crocatus: CMC5_006950Help
Entry
CMC5_006950       CDS       T04010                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccro  Chondromyces crocatus
Pathway
ccro00620  Pyruvate metabolism
ccro00680  Methane metabolism
ccro01100  Metabolic pathways
ccro01120  Microbial metabolism in diverse environments
ccro01200  Carbon metabolism
Module
ccro_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ccro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMC5_006950 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    CMC5_006950 (ppc)
Enzymes [BR:ccro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CMC5_006950 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 NIPSNAP
Motif
Other DBs
NCBI-ProteinID: AKT36577
UniProt: A0A0K1E7D3
LinkDB All DBs
Position
complement(895470..898136)
Genome map
AA seq 888 aa AA seqDB search
MLGHLLGEVLREQEGQALFDQEERIRLLSIRRRRGPHEGRAQAAAELAEALATLPAEQVE
PIIRAFTVYFRLVNLAEQHHRIRRARAHATDAEPQRGSLEATFLALRRAGVSAQRAREAA
QSLEVTLTVTAHPTEASRRTVLAKLFRLAEYLEQRDRCALTPVEQERALAAAREEITALW
QTDEIRHERPSVGDEVKNVAWYIEEILWDLLPDVSDQLERAFAHAYNEPLGALPNPVRIH
SWVGGDMDGNPRVTPEVLEDAILAYRVRGLRLLVRAAARLGDALSQSSRHVTPPPSLLAS
LDEDARRLPDVAATWAPRTEGEPWRRKLRFVQARLEATLALGEARRAFLRRRMDGHGSES
PAATPTGNEAAYSAPEELTKDLALVADTLVAAGCARSGAEEVRALLARVRVFGFSIAELE
ARAPAEDARAAARTLSSSTTVEVTSGAARLLGALDAIARAQREGGERACRTLILSMTQGP
DDVLAALACARAVGLGIKGTAGAHIDIVPLFESHDALNASADIVRALLDHPEYREHVKAR
GAQEVMIGYSDSSKEVGLLAAAAALRRTQEALPEIAREAGIALRIFHGRGESVARGGGPA
QQAILALPPGAVAGRYKATEQGEALDHKYARPQLALRTLELVLGGALLHTLDVQPRPGDA
QHARYAAAFDEMAEGGRRAYRALVWEDPRFERFFATATPLDAITRLNIGSRPSKRASGGM
ESLRAIPWVFSWTQNRAILPAWYGVGSGLASFGKKPGGVAQLREMAASWPFFSALLSSVE
MVLAKSEISIFARYAELAPADVRDAIAPRILEEHALTRRWIKRILDVSKLLDGNPTLKRS
IALRNPYVDPLSYLQIELLRSERAGADVRDRELLLTLNGIAAGMRNTG
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgctcggtcacctcctcggtgaagtcctccgggagcaggaagggcaggcgctcttcgac
caggaagagcgcatccgcctcctgtccatccgccgccgacgcggccctcacgagggtcga
gcccaggccgccgccgagctggccgaggcgctcgcgaccctccccgccgagcaggtggag
ccgatcatccgcgccttcaccgtctacttccggctggtcaacctggccgagcagcaccac
cgcatccggcgagcgcgcgcacatgcaaccgacgccgagccccagcgcggctcgctggag
gcgacgttcctcgccctccggcgcgcgggcgtctcggcgcagcgggcgcgcgaggcggcg
cagtcgctggaggtcaccctcaccgtgacggcacacccgaccgaggcctcacggcgcacc
gtgctcgcgaagctcttccggctggcggagtacctggagcagcgcgaccgctgcgccctc
acgccggtcgagcaggagcgcgcgctcgcggcggcccgtgaagagatcaccgcgctctgg
cagacggacgagatccgacacgagcggccctcggtgggggacgaggtgaagaacgtcgcc
tggtacatcgaggagatcctctgggacctcttgcccgacgtctcggatcagctcgagcgc
gccttcgctcatgcctacaacgagccgctgggcgcgctgccgaacccggtccggatccac
tcctgggtgggcggggacatggacgggaaccctcgggtgacgcccgaggtcctggaagac
gccatcctcgcgtaccgggtgcgcggcctccggctgctggtgcgggcggcggcacggctc
ggggatgcgctatcgcagtcgagccggcacgtgacgcctccgccttccttgctggcgtcc
ctcgacgaggacgcgcggcggctgcccgacgtggccgctacctgggcgccacggaccgag
ggggagccgtggcgccgcaagctccggttcgtgcaggcgcggctcgaggcgacgctcgcg
ctcggtgaggcacggcgcgctttcctgcgccggcgcatggacggccacggaagcgagtct
cccgcggcgacgccgaccggcaacgaggcggcgtacagcgcgccggaggaactcaccaag
gacctcgcgctggtggcggacacgctcgtggccgcggggtgtgcccgctccggcgcagag
gaggtccgcgcgctgctcgcccgggtgcgggtcttcggcttctccatcgccgagctggaa
gcgcgcgcccccgcggaggacgcccgcgctgccgcgcggacactctcgtcttccacgacg
gtggaggtgacctcgggggccgcgcggctgctcggcgccctcgacgccatcgcccgcgca
cagcgggagggtggggagagagcgtgcaggaccttgatcttgtccatgacccagggcccg
gacgacgtgctcgcggcgctggcgtgcgcgcgtgcggtcgggctggggatcaaggggacg
gcgggggctcacatcgacatcgtccccctcttcgaatcccacgacgcgctgaatgccagc
gcggacatcgtccgcgccctcctcgaccaccccgagtaccgcgagcacgtgaaggcccgc
ggcgcgcaggaggtgatgatcgggtacagcgactcgagcaaagaggtcggcctcttggcc
gccgccgccgccctccggcggacgcaggaggccctgccggaaatcgcgcgagaggcaggg
atcgcgctgcgcatcttccacgggcgcggcgagagcgtggcgcgcggcggaggtccggca
cagcaggcgatcctggccttgccgccgggcgccgtggcaggtcgctacaaggccaccgag
caaggggaggccctcgatcacaagtacgcgcggccccagcttgcgctgcgcacgctggag
ctggtgctcggcggcgcgctgctccacaccctcgacgtccagccgcgacccggtgacgcc
cagcatgctcgctacgcggcagccttcgatgagatggccgagggtggacgtcgcgcgtac
cgcgccctcgtctgggaggatccacgcttcgagcgtttcttcgcgacggcgacgcccctc
gacgcgatcacgcggctcaacatcggctctcgtccgagcaagcgtgcctcgggagggatg
gagtcgttgcgcgccatcccctgggtgttctcctggacgcagaaccgcgccatcctgccg
gcgtggtatggcgtggggagcggcctggcctctttcggtaaaaagccggggggcgtcgca
cagctccgcgagatggcggcgtcctggccctttttcagcgcgctgctcagcagtgtggag
atggtgctcgcgaagtcggagatctccatcttcgcacgctatgccgaactcgcccccgcc
gacgtccgtgacgcgatcgcgccgcgcatcctcgaggagcacgcgctcacgcgccggtgg
atcaagcggatactcgacgtgagcaagctgctggacgggaaccccacgctgaagcgctcg
attgcactgaggaacccctacgtcgatcctctctcctacctgcagatcgagctgctccgc
agcgagcgcgcgggtgccgacgtccgggatcgcgagctgctgctcacgctgaacggcatt
gcggcggggatgaggaacaccggctga

DBGET integrated database retrieval system