KEGG   Chondromyces crocatus: CMC5_019550Help
Entry
CMC5_019550       CDS       T04010                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ccro  Chondromyces crocatus
Pathway
ccro00473  D-Alanine metabolism
ccro00550  Peptidoglycan biosynthesis
ccro01100  Metabolic pathways
ccro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CMC5_019550 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CMC5_019550 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CMC5_019550 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccro01011]
    CMC5_019550 (ddl)
Enzymes [BR:ccro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CMC5_019550 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ccro01011]
 Precursor biosynthesis
  Amino acid ligase
   CMC5_019550 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 GARS_A ATP-grasp RimK B12-binding CPSase_L_D2 ATP-grasp_5 ATPgrasp_Ter HEAT_2 TTL
Motif
Other DBs
NCBI-ProteinID: AKT37812
UniProt: A0A0K1EAV5
LinkDB All DBs
Position
2608489..2610798
Genome map
AA seq 769 aa AA seqDB search
MRIALTHNLKITGSPEEAEFDSPETINAISAALERAGHEVERIEVSGPASRVIARLEALQ
PDLIFNTAEGHKGKTREAFYPSLFDEMGIPYTGSDAYAHAIALDKALTKRVLASYAVPTP
RARLIRRASLESGALDDVVFPVIVKPNFEGSSKGISSAWSVCEDAHELAEVIDRLLPRFE
AGLLIERYLRGFDVGCSFVDGLGEDGILDPVEYCIDPAVAGPYNVYDYYLKNARTEHVAF
RMAQLPSTVAQRIRALTGRIVRALDLKDHVRCEFRITPSSLGDRDHEVHFLEVDGLPSLE
PGQPVFVSSSQKGVDFDGVILAVVRSACRRRGLMHLLDGAPRKSPRGALRVGFAYNMRRA
EAAETDAEAEFDSPKTIQAIAEAIESYGHTVVPLEATPDLPRRIADASPDVVFNIAEGIR
GRGREAQVPALCELLGVPYSGSDATTLSLCLDKGLTKQILRSAGIDTAEWQVLSTGREKM
KAFRYPVIVKPNAEGTSKGITSSSVVHDEASARTAARQLIERYHQPALIEEYIPGREFTV
GLLGERRPKVLPPMEVVFNGSPSHPVYGFEEKLLGATAVSFECPAKLSAPEQKRIEKVAR
DTFMALDCRDVARVDLRMTKDGKVYVIEINPLPGLTPDFSDLCTIARVAGMDFRSLIGEI
MSGCLKRQREGREGRAPEPNAKPSTLPAAQVAQGGQVNAVQGVDRSATSAAPAVTPAALA
VTPAALAVTPAAPAVMASPPAPTIAPAPSAPSDKPAGGQPPGPRGVNGA
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgctctgacccacaacctgaagatcactggctctcccgaggaggcagagttc
gatagtccggagacgatcaacgcgatctccgcggcgctcgagcgggccgggcacgaggtg
gagcgcatcgaggtgagcgggccggcgtcgcgtgtcatcgcgcggctcgaggcgctccag
ccggacctgatcttcaacaccgccgaggggcacaagggcaagacgcgcgaggcgttctat
ccgtcgctgttcgacgagatgggcatcccgtacaccggctccgacgcctacgcgcacgcg
atcgcgctggacaaagcgctgacgaagcgggtgctggcgtcgtacgcggtgcccacgccg
cgcgcccggctgatccggcgcgcgagcctggagagcggcgcgctcgacgatgtcgtgttc
ccggtgatcgtgaagccgaacttcgaggggtcgtcgaaggggatctccagcgcctggagc
gtgtgcgaggacgcgcacgagctggccgaggtcatcgatcggctgctgccccgcttcgag
gcggggttgctcatcgagcgctacctgcgcgggttcgacgtgggctgctccttcgtggat
ggactgggagaggacggcattctcgatccggtcgagtactgcatcgaccctgcggtggcc
ggtccttacaacgtctacgactactacctcaagaacgcgcgcaccgagcatgtcgccttc
cggatggcgcagcttccttccacggtcgcgcagagaattcgtgcgctcaccggccgcatc
gtgcgcgccctggacctgaaggaccacgtccgctgcgaattccggatcacgccctcgtcc
ctgggagaccgggatcacgaggtgcatttcttggaggtggacgggctgccctcgctggag
ccggggcagccggtgttcgtctcctcgtcgcagaagggggtcgacttcgacggggtgatt
ctggccgtggtgcgcagcgcttgccggcgccgtgggctcatgcacctgctggacggggcg
ccgcgcaagtcccctcgcggggcgctgcgggtgggcttcgcctacaacatgcgccgggcc
gaggccgcggagacggacgcggaggccgagttcgactcgccgaagaccatccaggcgatc
gccgaggccatcgagagctacggccacacggtggtccctctggaggcgacgccagacctg
ccccgacgcatcgcagacgcctcgcccgacgtggtcttcaacatcgccgagggcatccgg
gggcgcggccgtgaggcccaggtgccggcgctctgcgagctgctcggcgttccctacagc
ggctcggacgcgacgacgctctcgctctgcctggacaagggcctcaccaagcagatcttg
cggtccgccggtatcgacacggcggagtggcaggtgctctcgaccggccgcgagaagatg
aaggcgttccgttaccccgtcatcgtgaagccgaatgccgaggggacgtcgaagggcatc
acctcgtcgtcggtggtgcacgacgaggcctcggcgcggacggcggcgcggcagctcatc
gagcggtaccaccagcccgctttgatcgaagagtacatcccgggccgggagttcaccgtg
ggcttgctcggcgagcgacgccccaaggtgctgccgcccatggaggtggtcttcaatgga
tccccttctcaccccgtctacggcttcgaagagaagctgctgggggccacggcggtgagc
ttcgagtgccccgcgaagctttccgcgcccgaacagaagcgcatcgagaaggttgcacgt
gataccttcatggcgctcgactgtcgggacgtggcgcgcgtcgatctgcgcatgacgaag
gacggcaaggtgtacgtgatcgagatcaatccgttgccagggctgacgccggacttcagc
gatctgtgtacgatcgcgcgggtcgcgggcatggatttccgatcgttgatcggagagatc
atgtccggctgcttgaagcggcagcgtgaggggcgtgaaggtcgcgcgccggagccgaac
gcgaagccttcgaccctccccgcagcgcaggtggcgcagggggggcaggtgaacgcagtg
cagggcgtcgaccggtctgcgacatcggcagcgccagccgtgacacccgcggcgctcgcc
gtgacacccgcggcgctcgccgtgacacctgcggcgcctgccgtgatggcgtcgcccccg
gcgccaaccatcgcccccgcgcccagcgcgccgtccgacaaacccgctggagggcagccg
ccgggtcctcgaggagtgaacggcgcatga

DBGET integrated database retrieval system