KEGG   Chondromyces crocatus: CMC5_048570Help
Entry
CMC5_048570       CDS       T04010                                 

Definition
(GenBank) uncharacterized protein
Organism
ccro  Chondromyces crocatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C AMP-binding KAsynt_C_assoc PP-binding adh_short adh_short_C2 ADH_zinc_N_2 ADH_zinc_N Thiolase_N ADH_N GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: AKT40701
UniProt: A0A0K1EIL2
LinkDB All DBs
Position
complement(6579910..6594252)
Genome map
AA seq 4780 aa AA seqDB search
MKLRPSEVSSLVDLLRWRAEHQPSTRAFTLLQEDGETEDGHLTYAEIDAAARSIAAQLQS
LGFEGKRVVLLFPASLGFVTAFFGCLYAGAIAIPAPPPSPSRIARTLPRLTGIVEDARPV
AVLTDRAGLALSPSLIEASPALGELRWLAVEEASAHADGRWRCPEPGRGSVAYVQYTSGS
TTAPKGTLISHGNLLAISEAVREAKSYDEDSRAVIWVPNYHDDGLIHGILQPIYTGYPCV
LMHPGTLVARPAQWLMAITRYRATHAGGPNFAYELCLRKVTDAQRERLDLSSWRMAYNAA
EPIRMETLQGFHERFAPCGFRWETHAPCYGLAEASLTVSAPRGQKGPRTLSVDAAALAQR
GEVVEVPSEHRTGRTVVGCGRPVLGARIAIVQPSTATECPPRTVGEIWLASDCVALGYLD
RPEATQETFHAHLADTGEGPFLRTGDLGFLADGELFITGRVKDLIIIRGENRYPQDIEWS
VQQAHGAVRPGGVAAFSIDVGDEERLGLVVETALARTGKNGAPGATQEQRDEVFGAIRQA
VAERHDLQVHAIALLPAGTIPKTSSGKIQRRACKDGFTAGALDEVARWTSPIPATTPARA
RDGAGERPRSPAASALSPTTPALSKSYDATRAWLIDHLATRLGVSPASIDIRAPFARFGL
DSAAGVAIAAELGDWLGRALPPTSAWDHPSIHALSLHLAGDDAPPRAVTTPLHERAVDEP
IAVIGMACRFPRAADRPEAYWQLLLDGVDAVGEVPKSRFDIDACFDPTPGVRGKTYARQG
AFLDEVATFDAGFFGVSPREATDMDPQQRLLLEVCWEALERAGQVVGGGDGVEGAVFVGV
STDDYADAHMRSGDPARIGPHAFTGVATSITAGRLSYALGLTGPSVAIDTACSSSLVAVH
LACQSLQAGECRFALAAGVNLILSPQNLIALSQLRALSPTGRLRAFDAAADGYVRGEGCG
VVVLKRLSHALADGDPILAVLRGTAINQDGTSNGLTAPSAAAQEAVIRKALDRAGISPRE
VTYVEAHGTGTPLGDPIEITALGAVYGEDRPADVPLWVGTAKTNIGHLESAAGIAGLMKV
VLSLQHGEIPPNRHFDVPSPFIPWERVPARVPTQRIPWERGQGRRVGAVSSFGMSGTNAH
VVLEEAPLREVTASRDVRLPALLPLSARSDAALLALAKLYEGQLDSLGDAPEALQALVST
AALRRAHHDHRMAVVGRDPKELAAALGAFTDGQAHAGLVSAQVAPRGRPRVAFVFPGYGG
QWVGMGRQLLAEEPVFAAAIAACEAALSEHVDWSLSAVLRGDADTPPLERTDVVQPVLFG
VGVSLAALWASWGVTPDAVVGHSLGEIAAAHVAGVLSLRDAAQVVCHRSRLMHRISGQGT
IGVVELPQEEVAKRLQGREHLLSVAVVNNPQTTGISGDPAALDALLSSLEAEGVFCRRVK
IDVASHSPQVEPLLPELREALKELSPQAEQCPIYSTVMGGVQEGGAFSAGYWARNVREPV
QFARAVQQLLDDGHTLFVEVGPHPVLLPAMEPMLRQAGDDVAAGVASLRRGQDERAALLL
SLGQLHVRGYPVRFEGLYPEGSPCASLPTYPFQRERFWLDRAPLVRASAGWSHGESDHPL
LGDTFRPSTQPGMHFWQTELRLPAIAWLADHRILDAIVLPASAYVDMALAAVERAIGPGV
HPLDTLTFHEALTLHEDQPRTVQVALAEEGQGTLSLRISSLAPQAVDQAWTLHVSATVQR
AAGEAEATPAPLSLAALQAQCPGALEVAQHYEALREQGLQYGPTFQRIQQLWQGDREALA
RLQPVEGNELHAVHPALLDAAFQTLSAAMPAARHRGPVMPVGLQQFRLFQRPGAEVWCHV
RLRDLPADARAVEGDVLLLDGDGQVIAEALGLRVQLLEAPRRAEEDLFLSLHWQPALAPV
LADPPSPGRLLVLADRSGTAQALLAALAEHGIPALAAVPHGVEFPTGVETVAFDPERSDG
LDAVLERAFAEGIPCRGVVHLLSLDATPPEATTAASLERDETVLCGSVIHLVQALDRRTS
RNPPRLWLVTRGVHRVVPSDERVAPAQAPLWGLARTLAYEHPELDCTRIDLGAQPAPDEV
HALVQELSTATRDEEEIALRSDGRFAARLLRRAETPREVPASALASAGDAVNPALRADGS
YLITGGLGGLGLSIARWMVDQGARHLVLLGRSGATTPEQHAALAALAEAGASVRVAQADV
QDATQLGQLLDDLRATLPPLRGIVHAAGVLDDALLLQQDVAKLRKVMAPKVAGAWNLHAL
TRETALDFFVLYSSGAALLGSPGQANYAAANAFLDALAHHRRALGLPAISIGWGSFSEAG
MAAAQASRGTRLAQRGLRSLTPAEGVAILGRLLGASDAQLGAVPIDLRQWIEFYPQAASS
PLLSELARGVTRGRRAATQRGTAREALRAVAPAARRAALERFVRDEVAHVLQLDPARIAW
RAPFKNLGVDSLTGLELRNRLEAGLGLTLSATLIWTYASVAALAEHLLEQLLPTLEVTPR
VAPSTVVTSARAALAEARPGAPARVSLPGAPDATRAPEGTPHDAQLQQALATIDALQDEL
AAQESLATEPIAIIGMSCRLPGGGTDPEAFWQVLERGVDGVREIPVERWPVGAPDKDLPG
TRWGGFLDQVDTFDAAFFGIAPREAQSLDPQQRLLLEVAWEALEHAGQPADRLVGSRTGV
FIGMMTLDYQRRVTARGVSHLDAYSATGTATCFAPGRLAYVLGLEGPTLAVDTACSSSLV
AVHLACQSLRKGESQMALAGGVNVMLSRTTMYLVAKTQAVSPDGRCKAFDASANGFVRGE
GCGVLVLKRLSDAQRDGDRIIALIRGSAVNQDGRSTGLTTPNVLSQQALLRQSLADARVE
PSELGYIEAHGTGTSLGDPIEMEALKAALGAPRADGSTCPIGSVKTNLGHLEAAAGVAGI
LKVVLSLQHETIPRHLHFKALNPRISLDDTPFYIPTERIPWRRGERRRVAGVSSFGMSGT
NAHVVLEEAPAQAVEAAATAVRLPLLLPLSARSPEALTALASLYAAHLGALKDDVSALRD
VVYTAGVRRAHHDHRAVAVGRDRAEIAAALIAFTEGRAHPGLSAGRVGPELRPRVAFVFP
GYGGQWVGMGRQLLAEEPVFAAAIAACEAALSEHVDWSLSAVLRGDADTPPLERTDVVQP
VLFGVGVSLAALWASWGVTPDAVVGHSLGEIAAAHVAGVLSLRDAAQVVCHRSRLMHRIS
GQGTIGVVELPQEEVAKRLQGREHLLSVAVVNNPQTTGISGDPEALDALLSSLEAEGVFC
RRVKIDVASHSPQVEPLLPELREALKGLSPQAEQCPIYSTVTGGVQEGGAFTAGYWARNV
REPVQFARAVQQLLDDGHTLFVEVGPHPVLLPAMEPMLRQAGEDVAAGVASVRRGQDERG
SLLSGLGGLYARGYPVRFEGLYPEGGQCASLPTYPFQRERFWLDDVSDPEATRDGAPRGG
DHPLLGGAFASSTQPGTHFWQAELRTDAPSWLADHRIQEAAVLPGAAYVEMALAAAERTL
GAGVHVLDTLTFHEALTLHEGQPTTVQIALTEEGGGGLSVRISSLNPQATARDWTLHASV
LVRAATPTAEGAVTPPRTSLEALQGQCATPVEAAHHYEALGAQGLQYGPAFQRVQQLWRG
DREALARLQPADPGEPYALHPALLDAAFQTLSAAVSASGPGGPAVPVALERVRLFQRPGA
EVWCHARLRDLPADARAVEGDVLLLDGNGQVIAEALGLRVQFLEAPRRTDDDLYLSLHWQ
PALAPVPAASPTAGRFLVLADRSGTAQALLTALVEQGIPALAVVPRGVAPPAGVEAVESD
LSTPAEVDALLERASADGVPCRGIVHLLGLDATSPAATTLASLEHDQAALCGSVLQILQA
HARRVTRNPPRLWLVTRGVHRVGASDRDVSIAQAPLWGLARTIAYEHPELDCTRIDLAAQ
PTPGEADALLQELLASTRDEEEIALRLDGRFAARLQRRAPEASATVDTPTLVPAADLAFR
LESDQPGVLDRLALRTTERRPPGPGEVEIRIQAAGMNFRDVLLALGALPNANPDEPLPFG
GECAGVVVAVGEGVTHLQPGQEVVAVARGTMGSFVTTPATLVLPKPARLTPEEAATLPIA
HLSAYYALAHVARLAPGERILIHAATGGVGLAAVQWARHVGAEIFATASSPEKHAHLRAL
GVQHISDSRSLRFVQDIQAWTQGEGVDVVLNSLSGDFIPKSLELLRDHGRFIELGMRDYV
ANAQLGLRPFLRNLSFALVDLMDMSRKRPERVRALFEEMLALVEQGALQPLPHTAFPIAA
HGDAFQHMVNARHIGKIVVTLDSPTVPVRPAAHPAFAVRADATYLITGGLGGLGLSLARW
LVTSGARHLALLGRSAPTTTAQHDALAELRALGATVLTEAVDVADRGALAATFARIAERM
PALRGVIHAAGVLDDRLLTAQDLESFRKVMAPKIAGAWNLHELTKALPLDAFVLYSSAAS
LLGSPGQGNYAAANAFLDALAHHRRALGLPALSVNWGAFSEVGLAASQDNRGSRLAQRGM
RGLSPAEGNDALGHLLAVGGDQLGVLALDVRQWIEFYPQAASSPLLSDLARDATRGKPRG
GGRSAVLDALHAAPSEARPGLLEQFLRDQVGQVLQLEPARIERHAPFKGLGIDSLTGLEL
RNRIEAGLRLTLSATLVWTYPTIATLTEHLGSKIGHGAGTAGAPGAGADAAGRPDVAIEV
AADAEGAADDDLMEQNLAGMSDEDFAALVQGELDGQGEEL
NT seq 14343 nt NT seq  +upstreamnt  +downstreamnt
atgaagctacgaccgtccgaggtttcgtcactggtcgacctgctccggtggagagccgag
catcaaccctcgacgagggccttcaccctcctccaggaagacggagagacggaggacggg
cacctcacctacgcagagatcgatgcggcggcccggtccatcgcggcacagcttcagtcg
ctcgggttcgaagggaagcgggtggtcctgctcttcccggcgagcctcggcttcgtcacg
gccttcttcggctgcctgtacgctggcgccatcgccattccggcgcctccaccgagcccg
tcccggatcgccaggaccttgccccgcctcacgggcatcgtcgaggacgcgcgtcccgtc
gcggtcctgaccgaccgggcggggctcgcgctctctccctcgctgatcgaggcgtctccc
gcgctgggcgagcttcgttggctggccgtcgaggaggcctcggcccacgccgacggacga
tggcggtgtcccgagcccgggcgaggctcagtcgcctacgtgcagtacacctcggggtcg
accaccgcccccaagggcacgctgatcagccacgggaacctgctcgccatctccgaggcc
gtgcgcgaggcgaagtcctacgacgaggacagcagagccgtcatctgggtccccaactac
cacgacgatgggctgattcacggcatccttcagccgatctacacgggctacccgtgcgtg
ttgatgcacccggggaccctggtcgcacggcctgctcagtggctcatggccatcacccgc
taccgcgcgacccacgccggcgggccgaacttcgcgtacgagctgtgcctccgcaaggtg
accgacgcgcagcgagagcgcctcgatctgagcagctggcgcatggcctacaacgccgcc
gagccgatccgcatggagacgctccagggcttccacgagcgcttcgcgccctgtggcttt
cgctgggagacgcacgctccctgctacggcctcgccgaggccagcctgacggtcagcgcg
cctcgaggccagaaggggccgcgcaccctctcggtggacgcggcggcgctcgcgcagcgg
ggagaagtggtcgaggtcccctccgagcatcgcaccgggcgcaccgtggtgggctgcggg
cggccagtgctgggagcgcggattgccatcgtccagcccagcacggcgaccgagtgtccc
ccgcgcaccgtgggggagatctggctcgcgagcgactgcgtggcgctggggtacctggac
cgccccgaggcgacgcaggagacgttccacgcccacctcgccgacacgggcgaggggccc
ttcctcaggacgggtgatctcggcttcctcgcggatggcgagctgttcatcaccggccgc
gtcaaggacctgatcatcatccgtggtgagaaccggtacccgcaggacatcgagtggtcg
gtgcagcaggcgcacggcgccgtccggcctggtggcgtggccgcgttctccatcgacgtg
ggggacgaggagcggctcggcctcgtcgtggagaccgccctcgcgcgcacgggcaagaac
ggcgcgccgggcgccacgcaggaacagcgcgacgaggtcttcggcgccatccgccaggcg
gtggccgagcgtcacgaccttcaggtgcacgcgatcgcgctgctgcctgctggcaccatc
ccgaagacgtcgagcggcaagatccagcgacgcgcttgcaaggacggcttcacggcggga
gcactcgacgaggtcgcgcgctggacgagcccgatcccggcgacgacccccgcgcgcgcc
cgtgacggcgccggagagcgcccgaggtcgcccgcggcatctgccctctcgcccacgaca
cctgccctctcgaaatcgtacgacgcgacccgggcctggctcatcgaccacctcgcgacc
cgcctcggcgtgagcccggcgagcatcgacatccgcgccccgttcgcgcgcttcggtctc
gactcggccgctggggtggccatcgcggcggagctgggcgactggctcgggcgcgcgctc
ccccccacctcggcctgggatcacccgagcatccacgcgctgagcctccacctcgcgggg
gacgacgctccccctcgcgccgtgacgaccccgctccacgagcgcgccgtggacgagccc
atcgccgtcatcggcatggcgtgccggtttccgcgcgccgccgaccgccccgaggcgtac
tggcagctcctcctggacggtgtggacgcggtcggcgaggtcccgaagagccgcttcgac
atcgacgcctgcttcgacccgacgccgggcgtccgaggcaagacctacgcgcggcagggc
gccttcctggacgaggtggccaccttcgacgccggcttcttcggcgtgtccccgcgcgag
gcgaccgacatggacccgcagcagcgcttgctgctcgaggtctgctgggaggcgctggag
cgcgcggggcaggtcgtcggtggcggggacggcgtcgaaggggccgtgttcgtcggcgta
tccacggacgattacgccgacgcccacatgcgctcgggtgacccggccaggatcgggccg
cacgccttcaccggcgtcgccacgagcatcaccgcgggccgcctctcctacgcgctggga
ctcaccgggccgagcgtcgccatcgacacggcgtgctcctcgtctctcgtcgccgtccac
ctcgcgtgccagagcttgcaagccggggagtgcaggttcgctctggccgccggcgtgaac
ctcatcctctcgccgcagaacctgatcgcgctctcgcaactccgcgcgctctcgcccacg
ggccgcctccgcgcgttcgacgccgcggccgacgggtacgtgcgtggtgaagggtgcggc
gtcgtcgtgctcaagcgcctctcgcacgcactcgcagacggtgaccccatcctcgccgtc
ctccgcgggacggccatcaaccaggatggcaccagcaacggcctcaccgcgcccagcgcc
gccgcgcaggaggccgtgatccggaaggccctcgaccgcgctggcatctcgccgcgcgag
gtcacctacgtcgaggcgcacggcacggggacgccgctcggcgatccgatcgagatcacc
gcactcggcgcggtctacggtgaagaccgacccgccgacgttccgctgtgggtggggacg
gcgaagacgaacatcggccacctggagtcggccgccggcatcgccggtctcatgaaggtg
gtcctgtcgcttcaacacggcgagatcccgcccaaccgacacttcgacgtgccgagcccc
ttcatcccctgggagcgtgtcccggcgcgtgtcccgacccagcgcatcccctgggagcgc
gggcagggcaggcgcgtgggcgcggtgagctcgttcgggatgagcggcacgaacgcccac
gtggtgctggaagaagcgcccttgcgggaagtgaccgcgtcgcgagacgtgcgactcccg
gcgctgctgccgctctccgcccggagtgacgcggcgctgctcgccctggcgaagctttac
gaaggccagctcgattccctgggcgatgcgcctgaagcgctgcaggcgctggtctccacg
gcggcgcttcgacgcgcgcaccacgatcaccggatggccgtggtggggcgtgacccgaag
gagctggctgcggcactgggcgcgttcaccgatgggcaagcgcatgccggcctcgtgtcg
gcccaggtggcgcccagagggcgtccgcgggtggcgttcgtgttcccggggtacggtggg
cagtgggtggggatggggcggcagctgcttgcggaggagccggtgttcgcagcggcaatc
gcggcgtgcgaggccgcgctgagcgagcacgtggactggtcgctgtcggcagtgctgcgc
ggggacgcggacacgccgccgctggagcgaacggacgtggtgcagccggtgctgttcggc
gtgggggtctcgctggcggcgctgtgggcctcgtggggcgtgacgccggacgcggtggtg
ggccacagcctgggcgagatcgcggcggcgcatgtggccggtgtgctgagcctgcgggat
gcggcgcaggtggtctgtcaccgcagccggctgatgcaccggatcagcgggcaggggacg
atcggggtggtggagctgcctcaggaagaggtggcgaagcggctgcaaggacgcgagcac
ctgctgtcggtggcggtggtgaacaacccgcagacgacaggaatctcgggcgacccggcg
gcgctggacgcgctgctgtcgagcctggaagcggagggcgtgttctgccgccgggtgaag
atcgacgtggcctcgcacagcccgcaggtggagccgctgctgccagagctgcgcgaagcg
ctgaaggaactctcgccgcaggcggagcagtgcccgatctactcgacggtgatgggcggg
gtgcaggaaggcggcgcgttctcggccgggtactgggcgagaaacgtgcgagagccggtg
cagttcgcgcgtgcggtgcagcagctcctggacgacgggcacacgctgttcgtggaggtg
ggaccgcacccggtgctgctcccggcgatggagccgatgctgcggcaggcgggagacgac
gtcgcagcgggcgtggccagcttgcggcgcggccaggacgagcgtgcggcgttgctcctg
tcgctcgggcagcttcacgtgcgcggctacccggtccggttcgaggggctgtatcccgag
ggcagcccgtgcgcctcgctgccgacctatcccttccagcgggagcgcttctggctggac
cgcgcgccgctcgtccgcgccagcgccggatggagccacggcgagagcgaccacccgctc
ctcggggacacgttccgcccctccacgcagcccggaatgcacttctggcagaccgagctg
cgccttccggcgatcgcctggctcgccgaccaccggatcctggacgccatcgtgcttccg
gcgtccgcctacgtggacatggcgctggccgcggtcgagcgggccatcggcccaggggtc
caccccctcgacaccctgaccttccatgaagcgctcacgctccacgaagaccagccgcgc
accgttcaggtggcgctggccgaggaagggcaggggacgctctcgctgcgcatctcgagc
ctcgccccgcaggccgtggatcaggcatggacgctgcacgtctcggccaccgtgcagcgt
gctgccggagaggccgaggcgacgcccgctcccctgtcgctcgcggcgttgcaagcgcag
tgtcccggcgctctggaggtcgcgcagcactacgaggcgctccgtgagcaagggctccag
tacggcccgacgttccagcgcatccagcagctctggcaaggggaccgtgaggccctcgcc
cgcttgcagcccgtggaaggaaacgagctccacgcggtgcacccggcgctgctcgatgcc
gcgttccagacgctcagtgccgcgatgcccgctgcccgccaccgtggcccggtgatgccc
gtcgggctgcagcagttccgcctcttccagcgaccgggcgccgaggtctggtgccatgtc
cgcctgcgtgacctgcccgccgacgcgcgcgcggtcgagggggacgtgctcctgctcgat
ggcgatggccaggtgatcgccgaggccctcggcctgcgcgtgcagctcctggaggctccg
cggcgcgccgaggaggacctgttcctctccctgcactggcagcctgcgctcgcgcccgtt
ctcgccgatccgccctcaccagggcgccttctggtgctcgcggatcggagcggcacggcg
caggccctgctcgcagccctcgccgagcatggcattcctgcgctcgccgctgtgccccac
ggcgtggagttcccgaccggtgtcgagaccgtggcgttcgatccggagcgctccgacggc
ctcgatgccgtgctcgaacgcgccttcgcggagggcatcccctgccgcggcgtcgtccac
ctcctcagcctcgacgccaccccgcccgaggccaccacggcggcctccctggagcgtgac
gagaccgtcctctgcggcagcgtgatccacctcgtgcaggccctcgatcgcaggacctcg
aggaacccgccgcgtctctggctcgtcacccgtggcgtccaccgcgtcgtcccctcggac
gagcgcgtcgcgccagcccaggcgcccctctggggcctcgcgcgcaccctcgcttacgag
cacccggagctggactgcacccgcatcgacctcggcgcgcagcctgcgcccgacgaagtt
cacgccctcgtccaggaactgtccacggccacgcgggacgaagaagagatcgccctgcgc
tccgatggccgcttcgccgcgcggctcctgcggcgcgccgagaccccgcgcgaggtgccc
gcttcggcgctggcctcggcgggagacgcggtgaaccccgccctccgcgcggatggtagc
tacctcatcaccggcggcctcggcggactcggcctctcgatcgcgcgctggatggtcgac
cagggagcgcgtcacctcgtcctcctcggcaggagcggcgccacgacacccgagcagcac
gcggcgctcgccgcgctcgccgaggccggcgcgtcggtccgggtcgctcaggccgacgtc
caggatgcgacgcagctcggccagctcctggacgatctacgcgccacactcccccccttg
cgcggcatcgtccacgccgccggtgtcctcgacgatgccctgctcttgcagcaggacgtc
gcgaagctccgcaaggtcatggcgccgaaggtcgcgggcgcgtggaaccttcacgccctc
acccgcgagaccgcgctcgacttcttcgtcctgtactcctcgggggcggcgctcctcggc
tctccaggccaggccaactacgccgcggccaacgccttcctcgatgccctcgcgcaccac
cgccgcgccctcggcctccccgcgatcagcatcggctggggaagcttctcggaagccggc
atggcggccgcccaggccagccgtggcacccgcctcgcccagcgcggcctgcgcagcctc
acccctgccgaaggtgtcgcgatcctcggccgcctgctcggcgcgagcgacgcccagctc
ggcgccgtgcccatcgacctgcgccagtggatcgagttctacccgcaggccgcctcctcg
ccgcttctctccgaactcgcgcgcggtgtcacccgggggcgtcgcgcggcgacccagcgc
ggcaccgcccgggaagccctgcgcgccgtcgccccagccgcccgccgcgccgccctggag
cgcttcgttcgtgacgaggtcgctcacgttctccagctcgaccctgcgcgcatcgcctgg
cgcgcccctttcaagaacctcggcgtcgactccctgaccggcctcgaactgcgcaaccgc
ctcgaagcgggtctcggtctgaccctctcggccaccctgatctggacgtacgccagcgtc
gcggcgctcgccgagcacctcctcgaacagctcctccccaccctggaggtcaccccgcgc
gtggcgccttccacggtggtgacctccgcccgggccgccctggcggaggctcgtcccggg
gctcccgcccgcgtctcgctccccggagcgcccgacgcgacccgcgctccggagggaacg
ccccacgacgcgcagctccagcaagcgctcgccaccatcgacgctctccaggacgagctc
gcggcccaggagagcctggcgacggaacccatcgccatcatcggcatgagctgtcgtctc
ccgggcggcggaacggatccggaagccttctggcaggttctggagcgaggcgtcgatggg
gtccgcgagatccccgtcgagcgctggcccgtcggcgcacccgacaaggacctgcccggc
acgcgctggggtgggttcctcgaccaggtcgataccttcgacgcagcgttcttcggcatc
gcgccccgcgaggcccagagcctcgacccgcagcagcggctcctcctggaagtcgcctgg
gaggcgctggagcatgccggccagcccgccgaccgcctcgtcggcagccgcaccggcgtg
ttcatcggcatgatgacgctcgactaccagcgccgcgtcaccgcccgcggcgtgagccac
ctcgacgcctactcggccaccggcacggccacgtgcttcgcgccaggacgcctcgcgtac
gtcctcggcctcgaaggccccacgctggcggtggacaccgcgtgctcctcctcgctcgtc
gcggtgcacctcgcctgccagagcttgcgcaagggcgagagccagatggcgctcgcgggg
ggcgtcaacgtcatgctctcccgcaccacgatgtacctcgtggcgaagacgcaagccgtc
tcccccgacggccgctgcaaggccttcgacgccagcgccaacggcttcgtccgcggcgag
ggctgcggcgtcctggtgctcaagcgcctctcggacgcgcagcgcgacggcgaccggatc
atcgcgctgatccgcggctccgcggtcaaccaggatggccgctccaccggcctcaccacc
cccaacgtgctctcgcagcaggccctcctgcgccagtcgctcgcggacgcgcgcgtcgag
ccctcggagctggggtacatcgaggcacacgggacggggacctccctcggcgatcccatc
gaaatggaggccttgaaggccgcgctgggcgccccgcgtgcggacggctccacgtgcccc
atcggctcggtgaagacgaacctcggccacctcgaagcggccgccggggtcgccgggatc
ctcaaggtcgtgctctcgctccagcacgagaccatcccccgccacctgcacttcaaggcg
ctgaacccgcgcatctcgctcgacgacacgcccttctacatcccgaccgagcgcatcccc
tggcgtcgtggggagcggcggcgcgtggcaggcgtgagctcgttcgggatgagcggaacg
aacgcccacgtggtgctggaggaggcgcccgcccaagcggtcgaagcggctgcaacagcc
gtgcgcttgccgcttctgctcccgctctccgcgcgcagcccggaggccctgacggctctg
gcttcgctctacgcggcgcacctcggcgccctgaaggacgacgtctcggccctccgcgac
gtggtctacacggccggtgtgcgccgggctcaccacgatcaccgcgccgtcgccgtcggc
cgggatcgcgcggagatcgccgcggcattgatcgccttcacagaggggcgtgcgcatcct
ggtctcagcgcggggcgtgtcggtcccgagcttcgtccccgggtggcgttcgtgttcccg
gggtacggtgggcagtgggtggggatggggcggcagctgcttgcggaggagccggtgttc
gcagcggcgatcgcggcgtgcgaggccgcgctgagcgagcacgtggactggtcgctgtcg
gcagtgctgcgcggggacgcggacacgccgccgctggagcgaacggacgtggtgcagccg
gtgctgttcggcgtgggggtctcgctggcggcgctgtgggcctcgtggggcgtgacgccg
gacgcagtggtgggccacagcctgggcgagatcgcggcggcgcatgtggccggtgtgctg
agcctgcgggacgcggcgcaggtggtctgtcaccgcagccggctgatgcaccggatcagc
gggcaggggacgatcggggtggtggagctgcctcaggaagaggtggcgaagcggctgcaa
ggacgcgagcacctgctgtcggtggcggtggtgaacaacccgcagacgacagggatctcg
ggggacccggaggcgctggacgcgctgctgtcgagcctggaagcggagggcgtgttctgc
cgtcgggtgaagatcgacgtggcctcgcacagcccgcaggtggagccgctgctgccagag
ctgcgcgaagcgctgaaggggctctccccgcaggcggagcagtgcccgatctactcgacg
gtgacgggcggggtgcaggagggcggcgcgttcacggccgggtactgggcgaggaacgtg
cgtgagccggtgcagttcgcgcgcgcggtgcagcagctgctggacgacggtcacacgctg
ttcgtggaggtgggcccgcacccggtgctgctgccggcgatggagccgatgctgcggcag
gcgggggaagacgttgcagccggtgtcgccagcgtgcgacgcggccaggacgagcgcggg
tcgctgctcagcgggctgggagggctgtacgcgcgcggctacccggtccggttcgagggg
ctgtaccccgagggaggccagtgcgcctccctgccgacctatcccttccagcgggagcgc
ttctggctggacgacgtgtccgacccggaggccacgcgcgacggggccccccgcggaggg
gatcacccgctgctgggtggcgccttcgcgtcatcgacgcagcctggaacgcacttctgg
caagccgagctgcgaacggatgctccctcgtggctcgccgatcaccggatccaggaagcc
gccgtgcttcccggtgcggcctacgtggagatggccctcgcggctgccgagcgtaccctc
ggcgctggcgtccacgtcctcgacacgctgaccttccacgaggcgctgacactgcacgaa
gggcagcccaccacggtgcagatcgcgctgaccgaggaagggggagggggcctctcggtg
cgcatctccagcctgaacccgcaggcgacggcgcgggactggacgctccacgcttcggtg
ctggtgcgcgcggcgacccccacggccgagggcgcggtcaccccgccacggacgtccctc
gaagccttgcaggggcagtgcgcgaccccggtggaggcggcgcaccactacgaggcgctc
ggtgcgcaagggctccagtacggcccggcgttccagcgcgtccagcagctctggcgagga
gaccgcgaggccctcgcccgcttgcagccggcggatcccggtgagccgtacgcgctccat
cccgccctgctcgacgccgctttccagacgctcagcgcggccgtgtccgcgtcgggccct
ggcggcccggccgtgcctgtcgcgctggagcgcgtccgcctcttccagcgccctggcgcc
gaggtctggtgtcacgcgcgcttgcgtgacctgcccgccgacgcgcgcgccgtcgagggc
gacgtgctccttctggatggcaatggccaggtgatcgccgaggccctcggcctgcgcgtg
cagttcctggaggcacctcggcgtaccgacgacgacctctacctctcgctgcactggcag
ccggccctcgcgcccgtgcctgccgcgtcacccacggcgggacgctttctggtgctcgcg
gaccggagcggcaccgcgcaggcgctcctcacggccctcgtcgagcagggcatcccggcc
ctcgccgtcgtccctcgtggcgtggcgcctccggccggtgtcgaggccgtcgagagcgac
ctctccacccccgccgaggtcgacgcgctgctggagcgcgcctcggccgacggcgtccct
tgccgcggcatcgtccacttgctcggcctcgacgccacctcgcccgcggccaccaccctg
gcctcgctggagcacgaccaggctgccctctgcggcagcgtcttgcagatcctgcaagcc
cacgcccgcagggtgacgaggaacccgccgcgcctctggctcgtcacgcgcggtgtccat
cgcgtcggcgcctcggaccgcgacgtctccatcgcccaggcgcccctctggggcctcgcc
cgcaccatcgcctacgagcacccggagctggactgcacccgcatcgatctcgcggcgcag
cccaccccaggagaagccgacgcgctcctccaggagctgctcgccagcacgcgggacgaa
gaggagatcgccctgcgcctcgatggccgcttcgctgcgcggctccagcgacgcgccccc
gaggcgtccgcgaccgtcgacacgcccaccctcgtgccggcggcggacctcgcgttccgc
ctggagagcgaccagcctggcgtcctcgatcgcctcgccctccgcaccaccgagcgccgc
cccccggggcccggcgaggtggagatccggatccaggccgcgggcatgaacttccgcgac
gtgcttctcgcgctcggcgcgcttccgaacgccaaccccgacgagcccctcccgttcggg
ggcgagtgcgcgggcgtcgtcgtcgccgttggcgagggcgtcacccacctccagccaggc
caggaggtcgttgccgtcgcccgcggcaccatgggctccttcgtcaccaccccggccacc
ctggtgctgccgaaacccgcacgcctcacgcccgaggaagcggcgaccctccccatcgcg
cacctctccgcgtactacgccctcgcgcacgtcgcgcggctcgctccgggggagcgcatc
ctcatccacgcggccacggggggcgtcggcctcgctgccgtccagtgggcacgccacgtc
ggcgccgagatcttcgcgaccgccagcagtccggagaagcacgcgcacctgcgcgccctc
ggcgttcagcacatctccgactcccgctccctgcgcttcgtgcaagacatccaggcctgg
acccagggcgagggggtcgacgtggtcctgaactccctctcgggcgacttcatccccaag
agcctggagctgctccgcgaccatggccgcttcatcgagctcggcatgcgcgactacgtc
gccaacgcgcagctcggtctgcggcccttcctgcgcaacctctccttcgcgctggtcgac
ctcatggacatgagccgcaagcgccccgagcgcgtgcgcgcgctgttcgaggagatgctc
gcgctcgtcgagcagggcgcgctccagccgctcccgcacaccgcgttccccatcgcggcc
cacggcgacgccttccagcacatggtgaacgcgcgccacatcggcaagatcgtcgtcacc
ctcgactccccgaccgtccccgtccggcctgcggcgcaccccgcgttcgcggtccgagcc
gacgccacgtacctcatcaccggaggcctcggcgggctcgggctctccctcgcgcgctgg
ctcgtcacctcgggcgcacgccacctcgccctcctcggccgcagtgcccccaccaccacc
gcgcagcacgacgccctcgccgagcttcgagcgctgggcgccaccgtgctcacggaggcc
gtcgacgtcgccgatcgcggcgcgctggccgccaccttcgcgcgcatcgccgagcgcatg
ccagcgcttcgcggcgtgatccacgccgccggcgtgctcgacgaccgcctcctcaccgca
caggacctggagagcttccgcaaggtcatggccccgaagatcgcgggcgcctggaacctt
cacgagctgacgaaggcgctgcccctcgacgccttcgtcctctactcgtccgccgcctcc
ctcctcggctcacccgggcagggcaactacgccgcggccaacgccttcctcgacgccctc
gcgcaccaccggcgtgccctcggtctccctgccctcagcgtcaactggggcgccttctcg
gaggtcgggctcgcggcctcgcaggacaaccgcggctcccgcctcgcgcagcgtggcatg
cgcggcctctcccccgcggaaggcaacgacgccctcggccacctcctcgcggtcggcggc
gaccagctcggcgtcctcgcgctcgacgtgcgccagtggatcgagttctacccgcaggcc
gcctcctcgccgctcctctcggacctcgcccgcgacgccacccggggcaagccgcgcggc
ggtggccgctctgccgtgctcgacgccctgcacgccgcgccctccgaggcgcgccctggg
ctgctcgaacagttcctccgcgatcaggtgggccaggtgctccagctcgaacccgcgcgc
atcgagcgccatgcgcccttcaagggcctcgggatcgactcgctcaccggcctggaactg
cgcaaccggatcgaggccggcctccgcctcacgctgtcggcgacgctggtctggacgtac
cccaccatcgccaccctgaccgagcacctcggcagcaagatcggtcacggagcagggacc
gctggtgcgccgggtgcaggcgccgacgcggcggggcggcccgacgtggcgatcgaggtg
gccgcggatgcggaaggcgcagccgacgacgacctgatggagcagaacctggccggcatg
tccgacgaggacttcgccgccctggtccaaggcgagctggatggtcaaggcgaggagctt
tga

DBGET integrated database retrieval system