KEGG   Chondromyces crocatus: CMC5_053600Help
Entry
CMC5_053600       CDS       T04010                                 

Definition
(GenBank) peptide synthetase
Organism
ccro  Chondromyces crocatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation Bac_luciferase PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AKT41199
UniProt: A0A0K1EK18
LinkDB All DBs
Position
complement(7266744..7273328)
Genome map
AA seq 2194 aa AA seqDB search
MMKSFVRSEEAVMPSSSTLVELLRWRAAIAPAQRACTFLLDGENDEISTTYAELDRKARA
IASALQQLDAVGQRVLLLYPPGLDYVAAFFGCLYANTIAVPAYPPSMARLERTLPRLRAI
AVDAQATVVLTTAALLSIAEGLAAHDPAFGRMRWVATDSLVEGMEDAWKDPQSSRDTLAF
LQYTSGSTTTPKGVMLTHGNLLYNLELIAEGFGHGPGSVGVIWLPPYHDMGLIGGILQPI
FMGFPVTLMSPVAFLQRPARWLQAISRYRATTSGGPNFAYDLCVRRIAPEQRATLDLGSW
EVAFTGAEPVREETLRRFEEAFAPCGFQRRAFYPCYGLAEASLIVSGGRKLDLPVSRSFD
RTGLEQHRVRELAGSEAEARALIGCGPSLRGQQVVIVHPEQRTHCAEDEIGEIWVQGPSV
AQGYWEREEETARAFRVRPEGQAEGAYLRTGDLGFFHDGELFVTGRLKDLIIVRGRNHVP
QDIELTVERSHPALRPGCGAAFAVEIEAEERLVVVQEVERQHRRDDLGEVAAAVRQAVLE
QHELGVYGVVLLKAGSIPKTSSGKIQRFACRAGFLDGSLEALFRGVLEGADEAAAVVAEE
GSTLDADTLRALPPAARQTLLEAHLRALLGRVLRLPAAALAEARPLSALGLDSLVSLEIQ
HDIEGRLGVVLPLTSLLRGATLGELVREVLVLVEAGEEGRGGARLCSAGELPEAFPLSHG
QRALWFIHQLAPDSAAYNIAAAVRITSAVDTTALGGALQRLVERHPALRTTFTTRDGVPI
QRIHEAREVSFEVHDAASWSAEVLEERLADEAHVAFDLERGPLLHFRLFPRAAEGQVLLV
AMHHLVGDFWSLSVLIKELQLLYGAEKAGRDAGLAPLPMHYADFVRWQGERLMGAEGERL
WGYWRERLSGELPSLSLPTDRPRSPVQTYRGATRAFALDPALTAALRRLGEAHGATLYAT
LLAAFQALLARYTGQDDILVGSPMAGRTRAELANLFGYFVNPVVLRADLSSDPSFAQLLA
QVRGTVIEAIEHQDYPFALLVERLHANRDPSRSPIFQVLFTLQKAPFAGYEGLSSFAVGT
PGEPLALGDLTLAAMPLAQRTSQFDLSLTMAETRDGLAGSFQYNADLFDPETIARLAGHL
EVLLRGVVEHPDMPVAVLPLLTAEERERMLVAWNRTTVSYPREACIHELFEARARQAGDA
VALVFGDVRVTYAELDRRANQLAHHLRGLGVGPAVRVGLCVARSPELLVGMLGILKAGGA
YVPLDPAYPRERLAFMLEDAQVPVLVTQERLAGIVPTYAGRVVAVDAAWARMAQVARESA
APPPAIGVTAEHPAYVLYTSGSTGKPKGVIVAHRNVVNFFTGMDERVGCDETDTLLAVTS
ISFDISALELLWTLTRGARVVLLSERAASGGTLRAEPARRAKPMQFSVFYFASADGGEEV
GASKYRLLFEGAKFADRNGFSSIWTPERHFHAFGGLYPNPAVTSAALAAITENLQIRAGS
VVLPLHHPIRVAEEWSLVDNLSGGRVGIAFASGWHANDFVFFPERFQGRKAYMFEEIETV
RKLWRGEGIRVRSGAGNEIEVAIFPKPVQRELPIWITAAGTAETFIKAGEIGANVLTHLL
GQSVEEVAENIRLYRDALERSGHGRDAGQVTLMLHTFVGEDREAVRAKVKKPFTDYLRTS
IGLIENLIRSLGLSLDLRTMSEQDMQDLLQFAFDRYFETSALFGTPATCAAMVERLREIG
VDEIGCLIDFGVDVDATMESLRHVTAVMAQVNAQAGAEDASLVTQARRHRPSLLQCTPSM
MRLLLLDPEAAEALQPLRALLLGGEALPSALAREVKQSLPCRLINMFGPTESTIWSATQE
IGDAEEPITIGRPIANTQLYVLGPHAQPVPVGVAGELYIGGDGVAGGYLNRPELTEARFI
ANPFGVGEEGARLYRTGDRVRYLPDGRVEFLGRLDAQVKLRGFRIELGEIEVLLEAHPAV
KEAAVVVREDVPGDRRLVAYVVPERGAEPGGARGSLAASGAGSAAVVTEVLRAALRDRLP
DYMVPSVIVALEAMPLTSNGKTDRRALPAPEATRQGARAEYVAPQSELERLLASLWQQAL
KVEQVGVDDNFFDLGGHSLLLAQVHGQIGTVLGRQIPLIKLLEHPTIRSLARHLVQADAL
GEASFPDSVDRARKQRQGLERQRQSALKSRKKGP
NT seq 6585 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagagcttcgtgcgcagcgaggaggccgtgatgccgtcctcttccacactggtc
gagctgctgcgctggcgcgcagccatcgcgccggcgcagcgcgcctgcaccttcctgctg
gacggcgagaacgacgaaatcagcacgacctacgccgagctggatcggaaggcgagggcc
atcgcgagcgctctccagcagctcgacgcggtggggcagcgggtgctgctcctctatcca
ccggggctcgattacgtcgccgcgttcttcgggtgcctctatgcgaacacgattgctgtg
ccggcatacccgccgagcatggcgcggctcgagaggacactgccacgactgagggccatc
gccgtcgacgcgcaggccaccgtggtgctcacgacggcggcgctcctctcgatcgccgaa
gggctcgcggcccacgatcccgccttcggtcggatgcgctgggtggcgaccgactccctc
gtagagggcatggaggacgcctggaaggacccacagtcgagccgggatacgctggccttc
ctccagtacacctccgggtccacgacgacgccgaagggcgtcatgctgacccacggcaac
ctgctctacaacctggagctcattgccgagggattcggccatggccctgggagcgtgggg
gtgatctggctcccgccctatcacgacatgggcttgattggcgggatcttgcagcccatt
ttcatggggttcccggtgacgctgatgtcgcccgtcgccttcttgcagcggccggcgagg
tggctgcaggcgatttcccgctaccgcgccacgacgagcggaggcccgaacttcgcctat
gatctctgcgtgcgccggatcgcgccggagcagcgcgcaaccctggacctcggctcgtgg
gaggtcgccttcacaggggcggagcccgtgcgcgaagagacgctccggcgattcgaggag
gcattcgctccctgcgggttccagcggcgcgccttctacccttgctatgggctggccgag
gcttccctcatcgtgtccggagggagaaagctggatctgcccgtcagccggtccttcgac
cgcaccgggctggagcagcaccgggtgcgtgagcttgcgggcagcgaggccgaggcgcgc
gctctgatcgggtgtggacccagcttgcgagggcagcaggtcgtgatcgtccatcccgag
cagcggacgcactgcgccgaggacgagatcggcgagatctgggtccaggggccgagtgtg
gcccaggggtactgggagcgcgaggaggagacggcacgggcgttccgggtccgcccggaa
ggccaggcggagggggcttacctgcgcacgggagacctcggattcttccatgacggagag
ctgttcgtcacggggaggctcaaggatctgatcatcgtccgcggtcgcaaccacgtcccg
caggacatcgagctcaccgtggagcggagccatccggcgctgcgacctggatgcggggcg
gcgtttgcggtggagatcgaggcggaggagcgcttggtcgtggtccaggaggtcgagcgg
cagcaccgtcgcgatgatctcggtgaggtggccgcggcggtgcgccaggcggtgctggag
cagcacgagctgggggtgtacggcgtggtgctgctcaaggcggggagcatccccaagacg
tcgagcggcaagatccagcgcttcgcgtgccgggcgggatttctggatgggagtctggag
gcgctcttccgtggggtgctggaaggtgcggacgaggcggcagcggtggtcgccgaggag
gggagcacgctcgacgccgacacgctgcgggcccttccgcctgcggcgcggcagacgctg
ctcgaagcccaccttcgggcgctgctcgggcgcgtgctccgtcttccggccgctgcactg
gccgaggcgcgtccgctgagcgcgctggggctcgactcgctggtgtcgctcgagatccag
cacgacatcgaggggaggctgggggtggtcttgcccctgacgagccttctgcgaggcgcc
acgctgggggagctggtgcgcgaggtgctcgtgctcgtggaggcaggagaggagggccgt
ggaggagcgcggctctgctccgcaggggagctgccagaggcgttcccgctctctcacggg
cagcgcgcgctctggttcatccatcagctcgcgccggacagcgcggcctacaacatcgcc
gccgcggtccggatcacctcggcggtcgacaccacggcgctgggcggcgcgctccagcgg
ctcgtggagcgccacccggcgctccggacgacgttcacgacccgcgatggggtgccgatc
cagcggatccatgaggcgcgcgaggtgagcttcgaggtccacgacgcggcctcgtggagc
gccgaggtgctggaggagcggctggcggacgaggcgcacgtcgcgttcgatctggagcga
gggccgcttctccacttccgtctcttcccgcgggcggcggagggccaggtgctgctcgtc
gccatgcaccacctcgtgggcgacttctggtctctctccgtgctgatcaaggagcttcag
ctcctgtacggggcggagaaggcaggccgcgatgcaggcctcgcgccgctcccgatgcat
tatgcggatttcgtccgctggcagggcgagcggctcatgggggccgagggggagcgcctc
tgggggtactggcgtgagcgcctctcaggggagcttccgagcctctcgctgccgaccgat
cgccctcggtcgcccgtgcagacctaccggggcgcgacccgcgcgtttgcgctggacccg
gcgctcactgccgcgctgcgacgcctcggtgaggcgcacggggcgacactctacgcgacg
ctgctcgcggcgttccaggccctgctcgccaggtacacggggcaggacgacatcctcgtg
ggctcgccgatggcagggcgaacgcgggcggaactcgccaacctgttcgggtacttcgtg
aacccggtcgtcctgagggcggacctctccagcgacccgagcttcgcccagctgctcgcg
caggtgcgggggaccgtgatcgaggcgatcgagcaccaggattacccgttcgcgctgctc
gtggagcggctccacgcgaaccgtgatccgagccggtcgccgatcttccaggtgctcttc
accctgcagaaggcgccgttcgcggggtacgaggggctgtcctcgttcgcggtcgggacg
ccaggcgagccgctcgcgctcggggatctcacgctcgccgcgatgccgctcgcgcagcgt
acgtcgcagttcgatctctcgctgaccatggcggagacccgggacgggctcgcgggatcg
ttccagtacaacgcggatctcttcgaccccgagaccatcgcgcggctcgcagggcacctg
gaggtgctgctccgcggcgtcgtggagcaccctgacatgccggtggcggtgctgccgctg
ctgacggccgaggagcgggagagaatgctggtcgcctggaaccgcaccacggtgagctac
ccgcgcgaggcgtgcatccacgagctcttcgaggcgcgggcgcggcaggcgggtgacgcg
gtggcgctggtcttcggggatgtccgcgtcacctacgcggagctggatcgccgggcgaac
cagctcgctcaccacctgcgcggactgggcgtggggccagcggtccgggtcggcctgtgc
gtcgcacgctcgccggagctgctggtggggatgctcgggatcctcaaggcgggcggcgcg
tacgtgccgctggatccggcatacccgcgcgaacggcttgcgttcatgctggaggacgcg
caggtgccggtgctggtcacccaggaacgcctcgccgggatcgttcccacctatgcgggc
cgtgtggtcgcggtggacgcggcgtgggcccggatggctcaggtggcaagggagagcgca
gcgccaccgcctgcgatcggggtgacggcggagcacccggcgtacgtgctctacacgtcg
ggctccacgggcaagccgaagggcgtgatcgtggcccaccgcaacgtcgtcaacttcttc
accgggatggacgagcgggtcggctgtgacgagacggacacgctcctcgcggtcaccagc
atctcgttcgacatctcggcgctggagctgctctggacgctgacgcggggggcacgcgtc
gtgctcctgtccgagcgcgcggcgagcggtggcacgctgcgagcggagcccgcgcgtcgc
gcgaagccgatgcagttcagcgtgttctacttcgccagcgcggacgggggcgaggaggtg
ggggcgagcaagtaccgcctgctgttcgaaggcgcaaaattcgcggaccgaaacggcttc
tcttccatctggacgccggagcgccatttccacgccttcggtgggctgtatccgaacccg
gccgtgacgagcgcggcgctggcagcgatcaccgagaacctccagatccgtgcgggcagt
gtggtgctccccctgcaccacccgatccgcgtggccgaggagtggtcgctggtcgacaac
ctctccgggggccgcgtgggcatcgcgttcgcctcggggtggcatgcgaacgacttcgtt
ttcttcccggagcgcttccagggccgcaaggcgtacatgttcgaggagatcgagacggtg
cggaagctgtggcgcggggaggggatccgcgtgcgcagcggcgcggggaacgagatcgag
gtggcgatcttccccaagcccgtccagcgagagctgccgatctggatcacggcggctggg
acggccgagaccttcatcaaggcaggagagatcggcgcgaacgtgctcacccacctgctc
ggtcagagcgtggaggaggtggccgagaacatccggctctaccgcgacgcgctggagagg
agcggtcacgggcgtgacgcggggcaggtgacgctgatgcttcacaccttcgtgggagag
gatcgcgaggccgtccgggccaaggtgaagaagccgttcaccgactacctgaggacgtcg
atcggcttgatcgagaacctgatccggagcctcgggctctcgctcgatctcaggacgatg
agcgagcaggacatgcaggatctcttgcagttcgcattcgatcgctacttcgagacgagc
gcgctgttcgggaccccggcgacctgcgccgccatggtggagcggctacgcgagatcggc
gtcgacgagatcggctgcctcatcgacttcggcgtcgacgtggacgcgacgatggagagc
ttgagacacgtcacggcggtgatggcccaggtcaacgcccaggccggcgccgaggacgcg
tcgctggtgacccaggcgcggcgtcatcggccgtcgctcttgcagtgcacgccctcgatg
atgcgcttgctcctgctggatccggaggcggccgaagcgctgcagccgctgcgcgccctc
ctgctcggaggcgaggcgctcccttcggcgctggcgcgggaggtgaagcagtctcttccc
tgtcggctgatcaacatgttcggtccgacggagagcacgatctggtcggccacgcaggag
atcggggacgcagaagagccgatcaccatcggccgcccgatcgcgaacacgcagctctac
gtgctcgggccgcacgcgcagcccgtgcccgtcggtgtcgccggagagctgtacatcgga
ggcgacggggtcgccgggggttacctgaaccgacccgagctgaccgaggcgcgcttcatc
gcgaatccgttcggcgtcggggaagagggggcgcggctctacaggaccggcgatcgcgtc
cgctatctgccggacggccgggtggagttcctcgggcgcctggatgcgcaggtgaagttg
cgcggattccgcatcgagctgggggagatcgaggtgctgctggaggcgcatccggccgtg
aaagaggccgccgtcgtggtgcgcgaggacgtacccggtgacaggcggctcgtggcctac
gtcgtccccgagcggggcgcggagccaggcggcgccagggggagcctggcggcatcaggg
gcggggagcgcggccgtcgtgacggaggtgctgcgggcggcgctgcgggatcgcctgccc
gactacatggtgccgtcggtgatcgtcgcgctggaggcgatgccgttgacctcgaacggc
aagaccgaccgccgcgcgctcccggcccccgaggcgacgcggcaaggggcgagggccgag
tacgtcgcgccgcagagcgagctggagcggttgctggcgtccttgtggcagcaggcgctg
aaggtcgagcaggtcggcgtggacgacaacttcttcgacctgggggggcactcgctgctc
ctggcgcaggtccacgggcagatcgggacggtgctggggcggcagatcccgctgatcaag
ctgctggagcacccgaccatccgctcgctggcgcggcacctcgtgcaggcggacgcgctc
ggtgaagcgagcttccccgacagcgtcgatcgggcccggaagcagcggcaggggctggag
cgtcaacgtcagagcgcactgaagtcgcggaagaaggggccctga

DBGET integrated database retrieval system