KEGG   Chondromyces crocatus: CMC5_064690Help
Entry
CMC5_064690       CDS       T04010                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccro  Chondromyces crocatus
Brite
KEGG Orthology (KO) [BR:ccro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CMC5_064690 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccro02000]
    CMC5_064690 (gst)
Enzymes [BR:ccro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CMC5_064690 (gst)
Transporters [BR:ccro02000]
 Other Transporters
  Pores ion channels [TC:1]
   CMC5_064690 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_2 GST_C_3 GST_N_2
Motif
Other DBs
NCBI-ProteinID: AKT42246
UniProt: A0A0K1EN34
LinkDB All DBs
Position
8810603..8811277
Genome map
AA seq 224 aa AA seqDB search
MITQLIEGPRKRGELVVFHAPNSRSVGTLTLLDELGASYELRAIDLRADEQREPAYTGVN
PLGKVPALLHDGVLVTEQVAVTIYLADRFADAGLAPALDDPERGAYLRWIAFQGSSFEPA
MVDKAMKRTPAPRGVATYGEVEQVLSTLLGALERGPYLLGERFTAADVLWGISLGWLVSF
GLVPKEPAVVAYVERIKSRPSVARVADLDRTLVARFDAAKETAG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcacccagctcatcgaaggtccccgtaagcgcggcgaactcgtcgttttccatgca
ccgaacagccgctcggtcggaacgctcacgctgctcgacgagctgggcgcgagctacgag
ctgcgcgcgatcgacctgcgcgccgacgagcagcgcgagccggcatacacgggtgtgaat
ccgctcgggaaggtgcccgcgctgctccacgacggggtgctggtgacggagcaggtggcc
gtcacgatctacctggcagaccgcttcgccgacgccgggctcgcgccggcgctcgatgat
ccggagcgaggggcttacctgcggtggatcgcgttccagggttcgagcttcgagccggcg
atggtggacaaggcgatgaagcggacgcctgcaccgcgcggggtggccacctacggcgag
gtcgagcaggtgctgtcgacgctgctcggagcgctggagcgtgggccttacttgctgggg
gagcgttttaccgcggctgacgtgctctggggcatatcgctcgggtggctggtctccttc
gggctggtgccgaaggagccggcggtcgtcgcgtacgtggagcgcatcaagagccgcccg
agcgtggcgcgcgtcgccgatctcgatcggacgctggtggcgcgcttcgacgcggcgaag
gagactgccgggtag

DBGET integrated database retrieval system