KEGG   Caulobacter vibrioides NA1000: CCNA_00876Help
Entry
CCNA_00876        CDS       T00841                                 

Definition
(RefSeq) 7,8-dihydro-8-oxoguanine-triphosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
ccs  Caulobacter vibrioides NA1000
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccs03400]
    CCNA_00876
Enzymes [BR:ccs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     CCNA_00876
DNA repair and recombination proteins [BR:ccs03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    CCNA_00876
 Prokaryotic Type
    CCNA_00876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX_4 NUDIX NUDIX_2
Motif
Other DBs
NCBI-GeneID: 7329916
NCBI-ProteinID: YP_002516249
UniProt: A0A0H3C810
LinkDB All DBs
Position
complement(953903..954307)
Genome map
AA seq 134 aa AA seqDB search
MTKPIVLVAAAALIDVDGRVLICQRPQGKQLAGLWEFPGGKVEAGETPEQCLIRELQEEL
GIKVAQACLAPFVFASHSYESFHLLMPLYLLRRWEGQVTRKEHEALAWVKPDKLSDYPMP
PADEPLVAWLRDVL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcccatcgtcctcgtcgccgccgccgccctgatcgatgtcgacggccgcgtg
ctgatctgtcagcgcccgcagggcaagcaactggccggcctgtgggagtttccgggcggc
aaggtcgaggccggcgagacgccggaacagtgcctgatccgcgagttgcaagaagaactc
gggatcaaggtggcgcaagcctgcctggcgccgtttgtttttgcgtctcacagttacgag
tcttttcacctcctgatgccactctacttgctacgtcgctgggaaggccaagtgacgcgc
aaggagcacgaggcgctggcatgggtaaaaccggacaagctgagcgactatccgatgccg
ccggccgacgagcccctggtggcttggctgcgcgacgtcctctga

DBGET integrated database retrieval system