KEGG   Caulobacter vibrioides NA1000: CCNA_01242Help
Entry
CCNA_01242        CDS       T00841                                 

Definition
(RefSeq) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
ccs  Caulobacter vibrioides NA1000
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CCNA_01242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease
Motif
Other DBs
NCBI-GeneID: 7333635
NCBI-ProteinID: YP_002516615
UniProt: A0A0H3C7N3
LinkDB All DBs
Position
complement(1367607..1369202)
Genome map
AA seq 531 aa AA seqDB search
MAGNRLFLKKSIASIQKEAAHSQLKRTLGPINLMSLGVGAIIGAGIFVLTGQVASANAGP
AIMLSFIVAGIACALAGLCYAELASTMPVSGSAYTYAYGTLGEVFAWIMGWLLVLEYGVA
ASTVAVGWSGYVVSTLHALGINFPMIQVAGADAPMWATPLIQAVAAPGGGTMFAMTGTLN
LVAAIGIAMVSALLVVGVSESANVNNAIVVIKVIVLVTFIAVGAQYINPANWHPFIPEPT
GQPGEFGIGGIFRGAAIIFFAYVGFEAVSTAAAEAKNPSRDVPIGILGALIICTLIYMAV
AAVMTGVVPFRELASPAPIAVAIDRMGLEWADIPYAAAEGGKLNLLSFAIKIGAITGLSS
VMLVLCYGQTRIFYTMARDGLLPKVFAEIHPKFRTPWLGTILLGVVIAIAASFLPISLLG
DLVSLGTAVAFSIVCLSVIYLRIKHPDLPRPFKVPGGIFTAAAGIAACLFLPYQNFQPMI
VHAMNDNPLPLMILGGYAAVGAIIYIAYGYWHSKLAKGIDITEETDPNSPA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaacaggctatttttgaaaaagtcgatcgcgagcatccagaaggaggccgcg
catagccagcttaagcgtacgctgggtcccatcaatctgatgagcctgggcgtcggcgcc
atcatcggcgccggcatcttcgtgctgacgggtcaggtggcctcggccaacgccggcccc
gccatcatgctgtcgttcatcgtcgcgggcatcgcctgcgccctggccggcctgtgctac
gctgaactggcctcgaccatgccggtttcgggctccgcctacacctacgcctacggcacc
ctgggcgaggttttcgcctggatcatgggctggctgctcgtgctcgagtacggcgtggcc
gcctcgaccgtggcggtcggctggtcgggctatgtggtcagcaccctgcacgccctgggg
atcaacttcccgatgatccaggtcgccggcgctgacgccccgatgtgggcgacgccgctg
atccaagccgtggccgcgcccggcggtggcacgatgttcgccatgaccggcacgctgaac
ctggtggccgccatcggcatcgccatggtctcggccctgctggtggtcggcgtcagcgag
tccgccaacgtcaacaacgccatcgtggtcatcaaggtgatcgtgctggtcacgttcatc
gcggtcggcgcgcagtacatcaatccggccaactggcaccccttcatccccgagccgacc
ggtcagcccggcgagttcggcatcggcggcatcttccgcggcgccgccatcatcttcttc
gcctatgtcggcttcgaagccgtttcgaccgccgccgccgaggccaagaacccctcgcgc
gacgtgccgatcggcatcctgggcgccctgatcatctgtacgctgatctacatggccgtg
gccgccgtcatgactggcgtcgtccccttccgtgaactggccagcccggccccgatcgcc
gtcgctatcgaccgcatgggtctggaatgggccgacatcccgtacgccgcggctgagggc
ggcaagctgaacctgctcagcttcgccatcaagatcggcgccatcacgggtctgtcgtcg
gttatgctggtgctgtgctacggccagacccgcatcttctacaccatggcccgcgacggc
ctgctgccgaaggtgttcgccgagatccaccccaagttccgcaccccctggctgggcacc
atcctgctgggcgtggtgatcgccatcgccgcctcgttcctgccgatcagcctgctgggc
gatctggtgtcgctgggcaccgccgtggccttctcgatcgtctgcctgtcggtgatctat
ctgcgcatcaagcaccccgacctgccgcgtccgttcaaggtgccgggcggcatcttcacg
gcggcggccggcatcgcggcctgcttgttcctgccctatcagaacttccagccgatgatc
gttcacgcgatgaacgacaatccgctgccgctgatgatcctgggcggttacgccgccgtc
ggcgcaatcatctatatcgcctacggctactggcactcgaagctggccaagggtatcgac
atcaccgaagagaccgacccgaactcgcccgcctag

DBGET integrated database retrieval system