KEGG   Caulobacter vibrioides NA1000: CCNA_01298Help
Entry
CCNA_01298        CDS       T00841                                 

Definition
(RefSeq) translation elongation factor Tu (EF-TU)
  KO
K02358  elongation factor Tu
Organism
ccs  Caulobacter vibrioides NA1000
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ccs03012]
    CCNA_01298
   03029 Mitochondrial biogenesis [BR:ccs03029]
    CCNA_01298
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccs04147]
    CCNA_01298
Translation factors [BR:ccs03012]
 Eukaryotic Type
  Elongation factors
   CCNA_01298
 Prokaryotic Type
   CCNA_01298
Mitochondrial biogenesis [BR:ccs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CCNA_01298
Exosome [BR:ccs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CCNA_01298
  Exosomal proteins of breast cancer cells
   CCNA_01298
  Exosomal proteins of colorectal cancer cells
   CCNA_01298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 7333030
NCBI-ProteinID: YP_002516671
UniProt: A0A0H3CEJ3
LinkDB All DBs
Position
1423488..1424678
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHCNIGTIGHVDHGKTTLTAAITMTLAKSGGATAKKYDEIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKVDMVDDEELLELVEMEVRELLSSYQFPGDDIPITKGSALAAVE
GRDPQIGEEKILELMASVDAYIPQPERPVDMPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEVEIVGIRPVQKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLCKPGS
ITPHTKFVAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIIKLREGVEMIMPGDNAE
LDVELITPIAMEEKLRFAIREGGRTVGAGVVAKIVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagttcgaacgtactaagccgcactgcaacatcggcaccattggtcac
gttgaccatggcaagacgacgctgaccgccgcgatcacgatgacgctggcgaagtcgggc
ggcgcgacggccaagaagtacgacgaaatcgacgcggcgccggaagaaaaggcccgcggc
atcacgatcaacaccgcgcacgtggaatatgagacggccaaccgtcactacgcccacgtc
gactgccccggccacgccgactacgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgatcctggtggtttcggccgctgacggcccgatgccgcagacccgcgagcacatc
ctgctggcccgtcaggtcggcgtgccggctctggtcgtgttcatgaacaaggtcgacatg
gtcgacgacgaagagctgctggagctcgtcgaaatggaagtgcgcgagctgctgagcagc
taccagttcccgggcgacgacattccgatcaccaagggttcggctctggccgccgttgaa
ggtcgtgacccgcaaatcggcgaagagaagatcctcgagctgatggcttcggtcgacgcc
tacatcccgcagccggaacgccccgtggacatgccgttcctgatgccggtcgaagacgtg
ttctcgatctcgggtcgcggtacggtcgtcaccggtcgcgtcgagcgcggcatcgtgaag
gtcggtgaagaagtcgaaatcgtcggcatccgtccggttcagaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggaccaaggtcaagccggcgacaacgtgggcgtgctg
ctgcgcggcaccaagcgtgaagacgtcgagcgcggccaggtgctgtgcaagccgggttcg
atcaccccgcacaccaagttcgtggccgaagcctacatcctgaccaaggaagaaggcggc
cgtcacaccccgttcttcaccaactaccgtccgcagttctacttccgcacgacggacgtg
acgggcatcatcaagctgcgcgaaggcgtggaaatgatcatgccgggcgacaacgccgag
ctggacgtcgagctgatcaccccgatcgccatggaagagaagctgcgcttcgccatccgt
gaaggcggccgcaccgtcggcgccggcgtggttgcgaagatcgttgaataa

DBGET integrated database retrieval system