KEGG   Caulobacter vibrioides NA1000: CCNA_01602Help
Entry
CCNA_01602        CDS       T00841                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CCNA_01602
Enzymes [BR:ccs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CCNA_01602
Transporters [BR:ccs02000]
 Other Transporters
  Pores ion channels [TC:1]
   CCNA_01602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_2 GST_C_3 GST_N_2 GST_N_3 GST_C_6
Motif
Other DBs
NCBI-GeneID: 7331580
NCBI-ProteinID: YP_002516975
UniProt: A0A0H3C8D0
LinkDB All DBs
Position
1722517..1723155
Genome map
AA seq 212 aa AA seqDB search
MMYTLYGSPSTAGTAIHWMLLELGVPFDLKMLDFDKGEHKTAEYLALNPDGVVPTLIVDG
RPVTQMAALLTLLAERHPEAGFAPTPGSADRAAYLSWSFWLANSFQPHFRAWFYSHEPAG
GDAQEAVQAAARARIEAGLARLDAHLADQDYMVGKGFTTVDLLVTILCRWSRNMPKPATE
WPNLKRYLDRIRQRPALREAHTREGLTDWIDG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtacacgctctatggttcgcccagcaccgccggcacggccatccactggatgctg
ctggagcttggcgtcccgttcgatctgaagatgctggatttcgacaagggcgagcacaag
acggccgagtacctggcgctcaatccggatggtgtggttcccaccctgatcgtcgatggc
cggccggtgacccagatggcggcgctgctgaccctgctcgccgagcgtcatcctgaggcg
ggctttgcgccgacgccgggatcggccgaccgcgccgcctatctgagctggagcttctgg
ctggccaacagctttcagcctcacttccgggcctggttctattcgcacgagccggccggc
ggcgatgctcaggaggccgtgcaggccgccgctcgggcgcggatcgaggccggtctggcg
cggctggacgcgcatttggccgatcaagactacatggtcgggaagggtttcacgaccgtg
gatctgctggtcacgatcctgtgccgctggagccgcaacatgcccaagcccgcgaccgaa
tggccgaacctgaagcgctatctcgatcgcatccgccagcgcccggcgctgcgcgaggcc
catacgcgcgaggggctgaccgactggattgatgggtag

DBGET integrated database retrieval system