KEGG   Caulobacter vibrioides NA1000: CCNA_01961Help
Entry
CCNA_01961        CDS       T00841                                 

Definition
(RefSeq) biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00061  Fatty acid biosynthesis
ccs00620  Pyruvate metabolism
ccs00640  Propanoate metabolism
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01120  Microbial metabolism in diverse environments
ccs01130  Biosynthesis of antibiotics
ccs01200  Carbon metabolism
ccs01212  Fatty acid metabolism
Module
ccs_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCNA_01961
   00640 Propanoate metabolism
    CCNA_01961
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CCNA_01961
Enzymes [BR:ccs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CCNA_01961
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CCNA_01961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_5 GARS_A ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-GeneID: 7330101
NCBI-ProteinID: YP_002517334
UniProt: A0A0H3CAS3
LinkDB All DBs
Position
2104868..2106214
Genome map
AA seq 448 aa AA seqDB search
MFDKILIANRGEIALRVHRACKEMGIATVAVHSEADRNSMWVRLADESVCIGPAPAAKSY
LNIPSIIAAAEITGAQAIHPGYGFLSENARFAEIVGAHGFTFIGPKPEHIRMMGDKITAK
QAVKDAGIPVVPGSDGGVSTEEEAFEAAEKIGFPVLIKAAAGGGGRGMKVAQTREDLAEA
VSTARAEARAAFGDDTVYMERYLQKPRHIELQVIADSHGNVVHLGERDCSLQRRHQKVLE
EAPSPALSAEGRAKIGKVVVDAVKAIGYLGVGTIEFLWENDEFFFIEMNTRLQVEHPVTE
AITGIDLVREQIRIAAGLPLSFTQDDVVFEGHAIECRINAENARTFTPSPGVITDFHAPG
GLGVRLDSAIYTGYAIPPYYDSLIGKLIVHGRDRAECIARLKRCLGEMVVGGVETTIPLF
QDLLVQPDILAGDYNIHWLERWIKAQEA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaagatcctcattgcgaaccggggcgagatcgcgctccgggttcaccgcgcc
tgtaaggaaatgggcatcgccacggtggcggtccattccgaggccgaccgcaactctatg
tgggtgcgcctggccgacgaaagcgtctgcatcgggccggctccggccgccaagagctat
ctgaacatcccatcgatcatcgcggccgccgagatcaccggcgcccaggcgatccacccg
ggctatggcttcctgtcggaaaatgcccgcttcgccgagatcgtcggcgcgcacggcttc
accttcatcggtcccaagcccgagcacatccggatgatgggcgacaagatcaccgccaag
caggctgtgaaggacgccggcatcccggtcgttcccggctcggacggcggcgtgtcgacc
gaggaagaagccttcgaggccgccgagaagatcggcttccccgtcctgatcaaggccgcc
gccggcggcggtggtcgtggcatgaaggtcgcccagacccgtgaggacctggccgaagcg
gtctcgaccgcccgcgccgaggcccgcgccgcctttggcgacgacacggtctatatggag
cgctacctccagaagccgcgccatatcgaactgcaggtcatcgccgacagccacggcaac
gtcgtgcacctgggcgagcgcgactgctcgctgcagcgtcgtcaccagaaggtgctggaa
gaagccccctcgcccgccctgtcggccgaaggtcgcgccaagatcggcaaggtcgtggtc
gatgcggtcaaggccatcggctatctcggcgtcggcaccatcgagttcctgtgggagaac
gacgagttcttcttcatcgagatgaacacccgcctgcaggtcgaacacccggtcaccgaa
gccatcaccggcatcgacctggtgcgcgagcagatccgcatcgccgccggcctgccgctg
tcgttcacccaggacgatgtcgtcttcgagggtcacgccatcgagtgccggatcaacgcc
gagaacgcgcgaaccttcacgccctcgccgggcgtgatcaccgacttccacgcccccggc
ggcctgggcgttcgcctggattcggcgatctacaccggctacgcgatcccgccgtactac
gacagcctgatcggcaaactgatcgtgcatgggcgtgaccgcgccgaatgcatcgcgcgt
ctgaagcgctgcctgggcgagatggtggtcggcggtgtcgaaaccacgattccgctgttc
caggaccttctggtgcagcccgatatcctggccggtgactacaacatccactggctggaa
cgctggatcaaagcccaagaagcttaa

DBGET integrated database retrieval system