KEGG   Caulobacter vibrioides NA1000: CCNA_01989Help
Entry
CCNA_01989        CDS       T00841                                 

Definition
(RefSeq) (3R)-hydroxymyristoyl-ACP dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00061  Fatty acid biosynthesis
ccs00780  Biotin metabolism
ccs01100  Metabolic pathways
ccs01212  Fatty acid metabolism
Module
ccs_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CCNA_01989
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CCNA_01989
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccs01004]
    CCNA_01989
Enzymes [BR:ccs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CCNA_01989
Lipid biosynthesis proteins [BR:ccs01004]
 Fatty acid synthase
  Component type
   CCNA_01989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas AfsA 4HBT_2
Motif
Other DBs
NCBI-GeneID: 7333642
NCBI-ProteinID: YP_002517362
UniProt: B8GWR2
LinkDB All DBs
Position
complement(2135120..2135599)
Genome map
AA seq 159 aa AA seqDB search
MGDNAEQAVQTDIDIAEILARIPHRYPFLLVDRAEDYNPHQSIVGIKCVTINEPFFQGHF
PGNPVMPGVLIIEALAQTGAVLMSKSLEVDTEGKTIFFMSVDNARFRNPVRPGDVIRMEV
EVLRARSSIFKFKGVAKVGDKVAAEAEFAAMVVETGPKA
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacaacgcagagcaagcggtgcagaccgatatcgacatcgcggagatcctggcg
cgcatcccgcaccgttatccgttcctgctggtcgaccgggccgaggactacaatccccac
cagtcgatcgtcggcatcaagtgcgtgacgatcaacgagccgttcttccagggccacttc
cccggcaacccggtcatgccgggcgtgctgatcatcgaggccctggcgcagaccggcgcg
gtgctgatgagcaagtcgctggaagtcgacaccgagggcaagacgatcttcttcatgtcg
gtcgacaacgcccgtttccgcaatccggtccgccccggcgacgtgatccgcatggaagtc
gaggtgctgcgcgcgcgctcgtcgatcttcaagttcaagggcgtggccaaggtcggcgac
aaggtggcggccgaggctgagttcgccgccatggtcgtcgagacgggacccaaggcatga

DBGET integrated database retrieval system