KEGG   Caulobacter vibrioides NA1000: CCNA_02167Help
Entry
CCNA_02167        CDS       T00841                                 

Definition
(RefSeq) glutathione S-transferase
Organism
ccs  Caulobacter vibrioides NA1000
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_3 GST_N GST_C GST_C_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 7333417
NCBI-ProteinID: YP_002517540
UniProt: A0A0H3C9Q2
LinkDB All DBs
Position
complement(2320949..2321581)
Genome map
AA seq 210 aa AA seqDB search
MLIYGSSLSPFVRKTMVFATEKGLAYDTKVVRLGQPDPEFEACSPFGKIPGFQDGDFKIS
DSSAIITYLDAAYPEPNLIPTEPKARARTVWYEEYADSIFVGAAGPIFFNRVVGPRFMGA
EPDQAAIDKGINVAMPPVLDYLERTIPASGFLVEDRFTLADIAVASPFVNLEHAGFDFAK
WPKSKAYADAILARPSFEGIIKRERRMLGA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgctcatctacggctcgtcgctttcgccgttcgtccgcaagaccatggtgttcgccacc
gaaaagggtctggcgtatgacaccaaggtggtccgactgggccagcccgaccccgagttc
gaggcctgcagcccgttcggcaagattcccggcttccaggacggcgacttcaagatctcg
gactcctcggcgatcatcacctatctggatgcggcctatccggagccgaacctgatcccg
accgagcccaaggcgcgcgcgcggaccgtctggtacgaggaatacgccgactccatcttt
gtcggcgctgcgggcccgatcttcttcaaccgcgtggtggggccgcgcttcatgggcgca
gagcccgatcaggcggcgatcgacaaggggatcaatgtcgccatgccgccggtgctcgac
tatctggagcgcacgatcccggcgagcggcttcctggttgaggaccgtttcaccctggcc
gacatcgccgtggccagtccgttcgtgaacctggaacacgccggtttcgatttcgccaag
tggcccaagtccaaggcctatgccgacgccatcctggcccggccgtcgttcgagggcatc
atcaagcgcgaacgccggatgctgggggcttaa

DBGET integrated database retrieval system