KEGG   Caulobacter vibrioides NA1000: CCNA_02936Help
Entry
CCNA_02936        CDS       T00841                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CCNA_02936
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccs02000]
    CCNA_02936
Enzymes [BR:ccs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CCNA_02936
Transporters [BR:ccs02000]
 Other Transporters
  Pores ion channels [TC:1]
   CCNA_02936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 alpha-hel2
Motif
Other DBs
NCBI-GeneID: 7331367
NCBI-ProteinID: YP_002518309
UniProt: A0A0H3CAC6
LinkDB All DBs
Position
3097275..3097937
Genome map
AA seq 220 aa AA seqDB search
MIIVHHLNNSRSQRVLWLLEELGLPYEIKRYQRDAKTMLAPPELRAIHPLGKSPVITDGD
TVLAETGAIVEYIIAMYGGGRLTPTAGTPERLRYTYWLHYAEGSAMPPLLMKLVFTALPA
RAPGLMRGVVKSIAARALKGFVDPQLKAHMDYWEAELAKSTWFAGAELTGADIMMSFPLE
TAAQRAGAAERPRIKAFLERIHARPAYQRALQRGGPYDYA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcattgttcaccatcttaacaattcgcgtagtcagcgggtgctttggctcctcgaa
gagctgggcctgccctacgagatcaagcgctatcagcgcgacgccaagaccatgctggcg
ccgccggagctccgggcgatccacccgctgggcaagtcgccggtgatcaccgatggcgac
acggtgctggccgagaccggcgccatcgtcgagtacatcatcgccatgtacggcgggggc
cgactgacgccgacggccggcacgcccgagcgcctgcgctacacctactggctgcactat
gccgagggctcggccatgccgccgctcttgatgaagctggtgttcacggccctgcccgcc
cgcgcgcccggcctgatgcgcggcgtggtcaagtcgatcgccgctcgggccctgaagggc
ttcgtcgatccgcagctgaaggcccatatggactactgggaggccgagcttgccaagtcg
acctggttcgcaggcgcggagctgaccggcgccgacatcatgatgagcttcccgctcgaa
accgccgcccagcgcgccggggccgccgagcggccaaggatcaaggcgttcctcgagcgt
atccacgcccgccccgcctatcagcgcgccctccagcgcgggggaccgtacgactacgcc
tga

DBGET integrated database retrieval system