KEGG   Caulobacter vibrioides NA1000: CCNA_03013Help
Entry
CCNA_03013        CDS       T00841                                 

Definition
(RefSeq) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ccs  Caulobacter vibrioides NA1000
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CCNA_03013
Enzymes [BR:ccs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CCNA_03013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 AlaDh_PNT_C FAD_binding_3 FAD_oxidored NAD_binding_7 K_oxygenase Glutaredoxin DAO FMO-like NAD_binding_8 Thi4
Motif
Other DBs
NCBI-GeneID: 7333302
NCBI-ProteinID: YP_002518386
UniProt: A0A0H3CAI8
LinkDB All DBs
Position
3165964..3167547
Genome map
AA seq 527 aa AA seqDB search
MLDAGLKAQLTTYLQNLRQPITLVASLDDSKGSVDMRALLDDVASTSDKVSVRFDGDDAR
KPSFAIERAANDAEVRFAGLPLGHEFTSLVLALLHVGGHPPRIDAEVIERIKALDGDYQF
ETYFSQSCQNCPDVVQALNTMSALNPRIRHVAIDGALFKAEVEARQVMAVPTILLNGQAF
GQGRMEIEQILAKLDTGAADRMAEKIRAKDAFEVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMDIENFISVPHTEGPKLASALEQHVKDYEVDVMNLQKAVGLVPAKTPGG
LHEIKLENGANLKARTLILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVTIIKSAMTTEIHGDG
SKVNGLTYKDRTSDTAHRVDLEGVFVQIGLVPNTEWLKDSGVALSPRGEIEVDYRGETSI
PGVFAAGDATVTPYKQIIIAMGEGAKASLSAFDYLIRLPASEAAEAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccggtctgaaagcccaactgaccacctatctgcagaacctgcgccagccg
atcacgctggtcgcctcgctggacgactccaagggctcggtcgacatgcgcgccctgctg
gacgacgtcgcctcgacctccgacaaggtcagcgtccgcttcgacggcgatgacgcccgc
aagccctcgttcgccatcgagcgcgccgccaatgacgccgaagtgcgtttcgccggcctg
ccgctgggccacgagttcacctcgctggtgctggctctgctgcacgtgggcggccacccg
ccccgcatcgacgccgaggtgatcgagcgcatcaaggcgctggacggcgactatcagttc
gagacctatttctcgcagtcgtgccagaactgccccgacgtggtgcaggcgctgaacacg
atgagcgccctgaacccgcgcatccgccacgtcgccatcgacggcgccctgttcaaggcc
gaggtcgaggcgcgccaggtgatggccgtgccgaccatcctgctgaacggccaggccttc
ggccagggccgcatggaaatcgaacagatcctggccaagctggacaccggcgcagccgac
cgcatggccgaaaagatcagggccaaggacgctttcgaggttctggtggtcggcggcggc
ccggccggcgcagcggcggcgatctacgccgcccgcaagggcatccgcaccggtgtggcg
gccgaacgcttcggcggccaggtgctggacaccatggatatcgagaacttcatctcggtg
ccgcacaccgaaggccccaagctcgccagcgcgctggagcagcacgtcaaggactatgag
gtcgacgtgatgaacctgcagaaggccgtgggcctggtcccggccaagacgccgggcggc
ctgcacgagatcaagctggagaacggcgccaacctgaaggcccgcaccctgatcctgtcg
accggcgcccgctggcgcaacgtcaacgtgcccggcgaggccgagtacaagaacaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaacagcggcgtcgaggcggccatcgatctggcgggcatcgtcgcccacgtg
accctgatcgagttcgacagccaactgcgcgccgacgcggtgctccagcgcaagctggcc
agcctgccgaacgtgacgatcatcaaatcggccatgaccaccgagatccacggcgacggg
tccaaggtgaacggcctgacctacaaggatcgcaccagcgacacggcccaccgcgtcgac
ctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctgaaggactcg
ggcgtggccttgtcgccgcgcggcgagatcgaggtcgactatcgcggcgaaacctcgatc
cccggcgtcttcgccgccggcgacgcgacggtgacgccctacaagcagatcatcatcgcc
atgggcgaaggggccaaggcctcgctctcggcgttcgactacctgatccgcctgccggcg
tcggaggcggcggaagcggcgtag

DBGET integrated database retrieval system