KEGG   Caulobacter vibrioides NA1000: CCNA_03744
Entry
CCNA_03744        CDS       T00841                                 

Definition
(RefSeq) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
ccs  Caulobacter vibrioides NA1000
Pathway
ccs00521  Streptomycin biosynthesis
ccs00523  Polyketide sugar unit biosynthesis
ccs00525  Acarbose and validamycin biosynthesis
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
Module
ccs_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ccs00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CCNA_03744
   01055 Biosynthesis of vancomycin group antibiotics
    CCNA_03744
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CCNA_03744
   00525 Acarbose and validamycin biosynthesis
    CCNA_03744
Enzymes [BR:ccs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     CCNA_03744
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 RmlD_sub_bind 3Beta_HSD adh_short NAD_binding_4 KR NAD_binding_10 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 7331941
NCBI-ProteinID: YP_002519117
UniProt: A0A0H3CDX1
LinkDB
Position
complement(3913617..3914687)
AA seq 356 aa
MSQQNLRVMVTGGSGFIGSAVCRHLAGQNNVAILNYDKLTYAASQASLAMLEGKADYQFV
QGDVADAARVCATIKAFRPDVVMHLAAESHVDRSITGPGDFIQTNIVGTYVMLQAALEHW
RGLEGEAKGRFRFHHISTDEVFGSLGAEGLFSETTPYDPRSPYSASKASSDHLARAWQHT
YGLPVVVSNCSNNYGPYHFPEKLIPLVTLNALEGKPLPVYGKGDNVRDWLHVEDHARALH
LIATKGVPGESYNVGGRNERTNLQVVEAICDILDELRPIPGQSRRDLITFVADRPGHDAR
YAIDATKLETELGWTAQETFDTGLRKTIQWYLDNEAWWAPLRERYAGQRLGLSKQA
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgtcgcagcaaaatcttcgcgtgatggtgaccggcgggtcaggcttcatcggctcggcc
gtgtgccgtcatctggccggccagaacaatgtcgcgatcctcaactacgacaagctgacc
tacgccgcctcgcaggccagcctggccatgctggagggcaaggccgactatcagttcgtg
cagggcgacgtcgccgacgcggcgagggtttgcgccaccatcaaggcgttccgccccgac
gtcgtgatgcatctggccgccgagagccatgtcgaccgctcgatcaccggcccgggcgat
ttcattcagaccaacatcgtcggcacctatgtgatgctgcaggccgctctggagcactgg
cgcggtttggaaggcgaggcgaagggccgcttccgcttccaccatatctcgaccgacgag
gtgttcggcagcctgggcgccgagggcctgttcagcgagacaacgccctatgatccgcgc
tcgccctattcggcgtcgaaggcttcatcggaccacctggcgcgggcctggcagcacacc
tatggcctgccggtcgtggtctccaactgctcgaacaactacgggccctatcacttcccc
gagaagctgatcccgctggtcacgctgaacgccctggagggcaagccgctgccggtctac
ggcaagggcgacaatgtccgcgactggctgcatgtcgaggatcacgcccgcgcgctgcat
ctgatcgcgacgaagggcgtgcccggcgagagctacaatgtcggcggccgcaacgagcgg
accaaccttcaggtggtcgaagccatctgcgacatcctcgatgagctgcgcccgattccc
ggccagagccgccgcgacctgatcaccttcgtcgccgaccgaccgggccatgacgcccgc
tacgccatcgacgccaccaagctggagaccgagctcggctggacggcgcaggagacgttc
gacacgggcctgcgcaagaccatccagtggtacctcgacaacgaggcctggtgggcgccg
ctgcgcgaacgctatgcgggccagcgcctgggcctgtcgaagcaggcttaa

DBGET integrated database retrieval system